KEGG   Alligator mississippiensis (American alligator): 102563674Help
Entry
102563674         CDS       T03087                                 

Gene name
MAPKAPK2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04218  Cellular senescence
amj04370  VEGF signaling pathway
amj04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102563674 (MAPKAPK2)
   04370 VEGF signaling pathway
    102563674 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102563674 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102563674 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amj01001]
    102563674 (MAPKAPK2)
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102563674 (MAPKAPK2)
Protein kinases [BR:amj01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   102563674 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 102563674
NCBI-ProteinID: XP_006267881
Position
Un
AA seq 381 aa AA seqDB search
MAARRGFAPPPAPPQPHPALQQQFPQFHVKAGLQIKKNAITDDYKVTTQVLGLGINGKVL
EIFSKKTGEKFALKMLQDCPKARREVELHWRASQCAHIVKIIDVYENLYQGRKCLLIVME
CLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRP
NTVLKLTDFGFAKETTTHNSLATPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCG
YPPFYSNHGLAISPGMKKRIRMGQYEFPNPEWSEVSEEVKQLIRNLLKTDPTQRMTITEF
MNHPWIMQSMQVPQTPLHTSRVLKEEKDLWEDVKEEMTSALATMRVDYEQIKIKKIEDSS
NPLLMKRRKKANPVEPTALPH
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcggcggggctttgccccgccgccggccccgccgcagccgcaccccgcgctc
cagcagcagttcccccagttccacgtgaaggcgggcctgcagatcaagaagaacgccatc
acggacgattacaaggtcaccacgcaggtgctgggcttgggcatcaacgggaaagttttg
gagatcttcagcaagaagacgggggagaaattcgccctcaagatgctgcaggactgccct
aaagcccgccgagaagttgaactccactggagggcctctcagtgcgcccatattgtaaag
atcatagacgtctatgaaaacctctaccagggaagaaagtgtctgctcatagtcatggaa
tgcttggatggcggggagctcttcagtcgcattcaagatcggggagaccaggccttcact
gagcgggaggcttcagaaataatgaagagcattggagaggccatccagtacctgcactcg
attaacatcgcccaccgggatgttaagccggaaaacctcttgtacacctccaaaaggccc
aacactgtcttaaagctcaccgactttggctttgctaaagaaaccaccacgcacaactcc
ctggccactccatgctacacgccttattatgtggccccggaggtgctgggcccagagaag
tatgacaagtcctgtgacatgtggtcccttggtgtcatcatgtatattttgctgtgtggt
tatccccctttctattccaaccacggtctggccatctctccaggcatgaagaagcggatc
cgaatgggccagtatgaattccccaaccctgagtggtccgaagtatcggaagaagttaaa
cagctgattcggaacctgctgaagacagacccaacccaacgcatgacgataacggagttc
atgaaccatccttggatcatgcaatccatgcaggtacctcagacgccactgcacactagt
cgagtgttgaaagaagagaaggatttgtgggaggatgtcaaggaggagatgacgagtgcc
ttggccaccatgcgcgtagactacgaacaaatcaagatcaagaaaatcgaagactcgtcc
aaccctttgctcatgaagaggcgaaagaaagcgaaccccgtcgagccgacagcactcccc
cactga

DBGET integrated database retrieval system