KEGG   Alligator mississippiensis (American alligator): 102563737Help
Entry
102563737         CDS       T03087                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 2-like
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00230  Purine metabolism
amj01100  Metabolic pathways
amj04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102563737
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102563737
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amj01001]
    102563737
Enzymes [BR:amj01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     102563737
Protein kinases [BR:amj01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   102563737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 102563737
NCBI-ProteinID: XP_014464026
UniProt: A0A151MPI4
Position
Un
AA seq 476 aa AA seqDB search
MRDIQLNHLTRFIGACIDPPNLCIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKG
MAFLHNSIIGHHGSLKSSNCVVDSRFVLKITDYGLASFRAAPDADDAHALYAKKLWTAPE
LLQKGQLPTQGMQKADVYSFGIILQEIALRNGPFYVEGMDLSPKEIVQKVRHSQAPFFRP
SIDLGVHSEELALLMERCWAQEPAERPDFSQVKVFIRRFNKEGSTSILDNLLSRMEQYAN
NLEKLVEERTQAYLEEKRRAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGF
TALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAHEI
VRMALALLDAVRTFRIRHRPSDQLHLRIGIHTGPVCAGVVGLKMPRYCLFGDTVXXXXRM
ESNGQALKIHVSSTTKEVLDEFGCFELELRGDVEMKGKGKMRTYWLLGERKNNMVA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacatccagctcaaccacctgacccgcttcatcggggcctgcatcgacccgccc
aacctctgcatcgtgacggagtactgcccgcggggcagcctgcaggacatcctggagaac
gagagcatcaacctggactggatgttccgctactcgctcatcaacgacatcgtcaagggc
atggccttcctgcacaacagcatcatcgggcaccacggcagcctcaagtcgtccaactgc
gtggtggacagccgcttcgtgctcaagatcaccgactacggactggccagcttccgcgcc
gcgcccgacgccgacgatgcccacgcgctctacgccaagaagctatggacagcgcccgag
ctgctgcagaaggggcagctgcccacccagggcatgcagaaggccgacgtctacagcttc
ggcatcatcctgcaggagatcgccctgcgcaacggccccttctacgtcgagggcatggac
ctgagtcccaaggagatcgtgcagaaggtgcggcacagccaggcgccgttcttccggccc
tccatcgacctgggcgtgcacagcgaggagctggccctgctcatggagcgctgctgggcc
caggagccggccgagcgccccgacttcagccaggtcaaggtcttcatccgccgcttcaac
aaggagggcagcaccagcatcctggacaacctgctgtcgcgcatggagcagtacgccaac
aacctggagaagctggtggaggaacggacgcaggcctacctggaggagaagcgcagggcc
gagaacctgctctaccagatcctgccccactccgtggccgagcagctgaagcgcggggag
acggtgcaggccgaggcctttgacagcgtcaccatctacttcagtgacatcgttggcttc
acagcgctgtcggcggagagcacccccatgcaggtggtgacgctgctgaacgacctgtac
acctgctttgacgccatcatcgacaactttgatgtctacaaggtggagacgatcggcgac
gcctacatggtggtgtcggggctgccagtgcgcaacggcaagctgcacgcccacgagatc
gtgcgcatggcgctggcgctgctcgacgccgtgcgcaccttccgcatccggcaccggccc
agcgaccagctgcacctgcgcatcggcatccacaccggcccggtgtgcgccggggtcgtg
gggctgaagatgccgcggtattgcctctttggggacacggtgnnnnnnnnnncgcgcatg
gagtccaacgggcaggccctgaagatccacgtctcctccaccaccaaggaggtcctggac
gagtttggctgcttcgagctggagctgcgcggggacgtagaaatgaaggggaaggggaag
atgcggacgtactggctgctgggcgagaggaagaacaacatggtcgcctga

DBGET integrated database retrieval system