KEGG   Alligator mississippiensis (American alligator): 102564044Help
Entry
102564044         CDS       T03087                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04060  Cytokine-cytokine receptor interaction
amj04068  FoxO signaling pathway
amj04210  Apoptosis
amj04217  Necroptosis
amj05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102564044 (FASLG)
   04068 FoxO signaling pathway
    102564044 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102564044 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102564044 (FASLG)
   04217 Necroptosis
    102564044 (FASLG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102564044 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amj04147]
    102564044 (FASLG)
   04052 Cytokines and growth factors [BR:amj04052]
    102564044 (FASLG)
   04090 CD molecules [BR:amj04090]
    102564044 (FASLG)
Exosome [BR:amj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102564044 (FASLG)
Cytokines and growth factors [BR:amj04052]
 Cytokines
  Tumor necrosis fators
   102564044 (FASLG)
CD molecules [BR:amj04090]
 Proteins
  102564044 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 102564044
NCBI-ProteinID: XP_019342033
Position
Un
AA seq 200 aa AA seqDB search
ALALLALLALAGAGLGLFQIVQLQKELAELREATSPGHLPPAAEKHTGLPNATEKIMEKK
EVRKAVHLTGKSGQKGLPLEWEAIYGHAFTSSIQYKQGSLMINETGLYFVYSSVFFRGEV
CNNQPLDHTVYKRNPGYPGNQVLMEDRRMNYCATQKMWAGNSYLGALFNLTRMDRLYVNV
SRIALVHFEESKTFFGVFKL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gcgctggcgctgctggcgctgctggcgctggcgggagcggggctcggcttgttccagatc
gtgcagctgcagaaggagctggcggagctgcgggaggccaccagccccgggcacctgccc
ccagctgcggagaagcacacagggcttccaaatgcaacagaaaagatcatggaaaagaaa
gaggtcaggaaagcagtacacttaacgggcaaatctggtcagaaaggccttcctctggaa
tgggaggccatctatggacatgccttcacttccagcattcagtataaacaaggaagcctg
atgattaatgaaactggcctgtactttgtgtactccagtgtgttcttccgaggtgaggtc
tgcaacaaccagcctttggaccatactgtttacaaacgaaacccaggttatccagggaac
caggttttaatggaggacagaaggatgaattactgtgcgactcagaaaatgtgggccggg
aacagctacctgggggcattgttcaacctcaccagaatggacaggctgtatgtcaatgtc
tccagaattgctctggttcattttgaagaatcaaagacattttttggtgtatttaaactt
tag

DBGET integrated database retrieval system