KEGG   Alligator mississippiensis (American alligator): 102565959
Entry
102565959         CDS       T03087                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amj01002]
    102565959 (ADAMTS13)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102565959 (ADAMTS13)
Peptidases and inhibitors [BR:amj01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102565959 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 TSP1_spondin ADAM_spacer1 Reprolysin_3 Reprolysin_5 TSP1_CCN Reprolysin_2 Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 102565959
NCBI-ProteinID: XP_014459218
UniProt: A0A151MFR6
Position
Un
AA seq 1597 aa
MSTRFMILAFTMFPLGFGWLSPFQEKFLRALDPEDVFSYFGTKSVLDVPEFIVVQPACAC
EEDQVGLTACKVQRCSLQSWGQLYTFEFLEDPDLLLPSFVSHRVLNTSVSLLKWFPGNCF
AEGKPLHPLGAVCRVSYCEGQLQGIIIASEEKIHIRPVRSKHWSLLKDLSFFKPHLIFRT
TGRGAKTAKEKKFHPRHWKRSEGTVKHLELLVAAGPDVYQFHREDTERYILTNLNIGAEL
LRDASLGAQFRVHLMRIIVLTEPEADLNITTNITSSLISVCEWSKKVNPPDDSDPQHADL
VLYVTRFDLELLNGNKELRGATQLGGACSSSWSCIITEDTGFDLGVTMAHEIGHSFGISH
DGEENSCSKSGFIMGTEGSHNNIDLAWSECSREQFLAFISTGQASCINDLPDLGGSIPGW
KPGLYYGVDEQCKVAFGAAATACTFADSNVDMCSVLSCHTNPAEQSSCTRLLVPLLDGTE
CGINKWCSKGRCSSLEELNPVTVVHGHWSSWSPFTSCSRICGGGVAMRQRFCNNPRPAFG
GQQCLGEDLQAEMCNTQACGTTQVDFMAEQCAATNPQPFYITAGVASFYNWTSAASDAAE
DILCKYMCRAAGKNFIGSRGEGFTDGTRCRPSGSDAHGAFSLCVMGSCRVFGCNGKMDSG
KVMDACKVCGGDNTTCTRVSGSYVEGKAREYVTFLALPGNSTEVHVVNRKPLFTHLAVKI
KGQYVVAGKGTISLNTTYPSVLEDSQIRYTLFLTQDHLPILEEIHVDGPTQEDIEIQVYR
KYGKEYGDKTSPDITFSYFVPKENQAFAWIPWRGTCSVTCGEGDQLVDHVCFDQTRDEII
DEQQCLETPRPPSRHEPCTMAPCPPSWAPGSFGQCSSSCGGGVMERLVRCVEKIGGLILT
LPDYKCIDSPKPASTELCNTQLCPLRWKGSEPGKCSAICGVGVAQQNLTCVQVHGDLETV
VDDSLCPVEEKPPSVVSCVVNICPFGWTTQEDTHPLAALVPAETIQKADRSVYVWSPLAG
DCSVTCGGGATQLHYVCVAFDTKEEAPEENCSSVPKPESRMEICNLSPCPPSWEVKELAP
CPVTCGGGRVPLSIRCIRQEGNTTHALPLSECIQIPWPTSSNECGTVPCPARWQYKTDSC
SASCGGGVTRRILYCARETGEKVEEIVADAQCHGLPRPEELELCNLEPCPPRWKIVRTSP
CSSSCGMGVAVQVVICVQIHQGLESQLEESLCPEAEKPISRIPCVIRMCSYEWGFTDWTE
CSASCGNGIQMRQDFCLNPKTHEHVNPVFCLRSPKPITVRGCSAGPCPKPSAAAKSSGEP
QMPSSSTNLLMMAVTVSPEKPKYKDLDLPPMGMPAPPLTGSEEDAAGMENTAGESSICGR
LFLNTTGVINMTGLQVNDCTVTIGRPLGEVVTVKVLESSLNCSAGEIVLFSGRLMWRTGC
RKLTMASLSTRTNTLIVRQRLVFLGNGIVFQYNSKAATKKHYQDCDVQLFGSRGEIVNPV
ESPDPRRQVACRTFITVAPRHRIAIRALYTDLGPESNHTYSSYILIRDVNTMKTIVFHGK
QLFFWESTGSQAEIEFHDDFTEGHGSFRAEYQVTEPR
NT seq 4794 nt   +upstreamnt  +downstreamnt
atgagcacccgctttatgatcttagcttttactatgttccccttgggcttcggctggcta
tctcctttccaagagaaatttctcagggctttggatccagaagatgttttttcttatttt
ggcaccaagtcagttcttgatgtacctgagttcattgttgttcagcctgcttgcgcctgt
gaagaagaccaggttggactgaccgcttgtaaagtccaacgctgttcccttcagtcatgg
ggacagctctacacctttgaatttctagaggatcctgatctccttctcccttcctttgtg
agccatcgagtgctgaacacttctgttagcttgctaaaatggttcccaggcaactgcttt
gcagagggaaaaccactgcatcctttgggggctgtgtgtagggtcagttactgcgaagga
cagctgcaaggcatcatcattgcaagtgaagaaaagattcacatcaggcctgtgagaagt
aaacactggagcctgctgaaggacctcagcttcttcaagccccacctcatcttcagaacc
acagggagaggggcaaagacagcaaaagaaaaaaagtttcatcctcgccattggaaaagg
tctgaagggactgtcaagcacctggagctgctggttgcagcgggcccagatgtgtaccag
ttccatagagaagacactgagaggtatatcctcaccaacctgaacattggtgccgaactg
ctgagagatgcttcgctgggagctcagttcagggttcacctcatgagaataattgtcctg
acagaaccagaggcagatctgaacatcaccacgaatatcacctcctccctcatcagcgtg
tgtgagtggagcaagaaggtcaatcccccagatgactcggatccccagcatgctgatctt
gtgctgtatgtgaccagatttgacctggagttactgaatgggaacaaagagcttcgtgga
gccactcagctgggtggagcctgctcctcctcttggagctgcattatcactgaggacact
ggctttgacttgggagtcaccatggcccatgagattgggcacagttttggaatctcccat
gatggtgaggagaactcttgcagtaagagcggcttcatcatgggcactgaaggcagccac
aacaacattgacctagcctggtcagagtgtagcagagagcaattccttgccttcatcagt
acaggccaagccagctgcataaatgacctgccggacctgggaggcagcatccctgggtgg
aagcctggcttatactatggcgtggatgagcagtgtaaagttgcctttggggccgcagcc
acagcttgcaccttcgctgacagcaatgttgacatgtgcagcgtcctctcttgccacaca
aacccagctgagcagtccagctgcactcgcttgcttgtcccccttctggatggtactgag
tgtggaatcaataagtggtgctccaagggccgatgtagctctctggaggaactgaaccct
gtcacagtggtacacggccactggtccagctggagccccttcacttcctgctcccgcatt
tgcggtggtggagttgcaatgaggcaacgattctgtaacaaccctaggcctgcttttgga
ggccagcagtgcctgggagaggacctccaagcagagatgtgcaacacccaggcctgcggg
acaacccaggtagacttcatggctgagcagtgtgccgctaccaaccctcagccattttac
atcactgcaggcgttgcgtctttttacaattggacttcggcagccagtgatgctgcagag
gacattctgtgcaagtacatgtgcagggcagctggcaagaacttcattgggagccgtggg
gagggcttcactgatgggactaggtgcaggccaagcggttccgacgctcacggcgcgttc
agtctctgtgtgatgggaagctgcagggtgtttgggtgtaatggtaagatggactccggg
aaggtgatggatgcttgcaaggtctgcggtggagacaacaccacatgcaccagagtgagc
ggttcctacgtggaaggaaaggccagagaatatgttacatttctggccctgcctggcaac
agcactgaggtccatgttgtcaatcggaaacccctcttcacgcatttagctgtgaagatc
aaaggtcagtatgtggtggctgggaagggaacaatctcattgaacactacctacccatca
gtactggaagacagccagatcagatacacgctgtttctcactcaggaccacctgccgatc
ctagaggaaatccatgtggatggaccaactcaagaggacatagagatccaggtttatcgg
aaatatgggaaagaatatggagataaaaccagtccagacatcaccttcagctactttgta
ccaaaggaaaaccaggcgtttgcatggattccatggcgtgggacctgctcagtgacctgt
ggggaaggggaccaattggtagatcacgtttgctttgaccagaccagggatgaaataata
gatgagcaacagtgtttggagaccccacgacccccttccaggcatgagccatgtaccatg
gcaccatgtcccccaagctgggcaccgggcagctttggtcaatgcagcagctcttgtggg
ggtggagtgatggagaggttggttcggtgcgtggagaagatagggggcttgatcctgact
cttcctgattacaagtgcattgattctcccaaacctgcttccacggagttgtgcaatacc
cagctgtgccccctaagatggaaaggatctgagccaggcaaatgctctgccatctgcgga
gttggggtggcccagcagaacctgacatgtgtccaggttcacggtgacttggaaacggta
gtagatgacagcctctgcccagtggaagagaaaccaccctccgttgtgtcatgtgtggtt
aacatctgcccttttggctggaccacacaggaagacacccaccccctggcggctttggtg
ccagctgagaccatccagaaggcagatcgctctgtgtatgtctggagtcctctagctgga
gattgctccgttacctgtggtggaggtgcgacccagctccactatgtgtgtgtggctttt
gataccaaagaagaagccccagaagaaaattgtagctcagtgccaaagcccgagagcagg
atggaaatctgcaatctcagcccatgcccgccgagctgggaggtgaaggagctggctccc
tgccctgtgacctgtggaggagggagggttccactgtccattcgctgcatcagacaagaa
ggcaacacaacccatgctcttcctctctctgagtgcatccagataccttggcccaccagc
agcaacgagtgtggcactgtcccgtgtccagcgaggtggcagtacaaaacagactcgtgc
agtgccagctgtggtgggggcgtgacacgccggatcctgtactgcgccagggagactggg
gagaaggtggaagagattgtagcagatgcgcagtgtcatggcctgcctcgcccagaggag
ctggagctgtgtaacctggagccgtgccctccgaggtggaaaatagttaggaccagccca
tgttcctcctcctgcggtatgggcgtagccgtgcaggtggtcatctgtgtccagattcac
cagggcctggagagtcagctggaagagagcttatgtcctgaggcagagaaacccatctcc
aggatcccctgtgtcatcaggatgtgttcgtatgaatggggcttcactgactggacggag
tgttcagcgtcatgtggaaatggcattcagatgcggcaggatttctgcctcaacccaaag
acccacgaacatgtgaaccccgtcttctgcctgcgctcccccaagcccatcactgtgcgt
ggctgctcagctggcccctgtcctaagccatctgctgcagccaagtcctcaggggaaccc
cagatgccatcttcatccacaaacctgctgatgatggcagtgactgtctctcctgaaaag
ccaaaatataaggacctggatcttcctccaatgggcatgccagcccctccactgacaggg
tctgaggaagatgcagcaggcatggagaacactgcaggagagtccagtatctgcgggagg
ctcttcctcaacaccacgggagtcatcaacatgaccggcctgcaggtcaatgactgcaca
gtcaccatcggccgtcccctgggggaagtggtaacagtcaaagtgctagagagctcctta
aactgcagtgcaggagagattgtgctcttttctgggcggctgatgtggcggactggctgt
aggaagctgaccatggcatctctcagcaccaggaccaacacactgatagtgagacagcgt
cttgtgttcctggggaacggcatagtttttcagtacaacagcaaagctgcaacaaaaaag
cattaccaagactgcgatgtgcagctgttcggctctcgaggagaaatcgtgaatcctgta
gagtctcctgaccccagaagacaagtggcctgtcgcaccttcatcaccgtggccccacgg
catcgcattgccattcgtgccctctacacggacctggggcctgagagcaaccacacatac
tccagttatatcttgatacgtgatgtaaacaccatgaagacaatcgtgttccatgggaaa
cagctattcttttgggagtcaaccgggagccaggctgaaattgaatttcacgatgacttc
acagaaggccacggcagtttccgagcagagtaccaggtcactgagcccagataa

DBGET integrated database retrieval system