KEGG   Alligator mississippiensis (American alligator): 102567754Help
Entry
102567754         CDS       T03087                                 

Gene name
GEMIN5
Definition
(RefSeq) gem nuclear organelle associated protein 5
  KO
K13133  gem associated protein 5
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj03013  RNA transport
Brite
KEGG Orthology (KO) [BR:amj00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102567754 (GEMIN5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:amj03019]
    102567754 (GEMIN5)
   03041 Spliceosome [BR:amj03041]
    102567754 (GEMIN5)
Messenger RNA biogenesis [BR:amj03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     102567754 (GEMIN5)
   mRNA cycle factors
    P-body specific factors
     102567754 (GEMIN5)
Spliceosome [BR:amj03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    102567754 (GEMIN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 WD40 Nup160 Lgl_C
Motif
Other DBs
NCBI-GeneID: 102567754
NCBI-ProteinID: XP_014465671
Position
Un
AA seq 1510 aa AA seqDB search
MAAERLLPASPNWYLSRCSDASAGARLFGFAARNSVYLLRVSAQPAFHGELIGHTERVSG
FTFCHFPDQTNLCASSSDDGTVKIWDTQTLSLVTEHTLHQNTISALHWSPLVKDLVVSGD
ERGIIVCYWHNRNDSQQFFPEPRTIFCLTCSPHQENLVAIGYKDGMVVIIDISRKKEIVH
RLRGHDDEIHSLAWCPVPNEEGLYSWQEELQAGEVPNGELTQEAAVAKGCYLASGSKDQT
IRIWSCARGRGVITLKLPSVKRRSGAVDPAVKERIWLTVHWPSDHPMELMSSCFGGELLL
WDLAQSGKRKWTLLGSSEGQNHSRIVFNLCSLRVQGRELLFSISMDRDVKCWDLATLDCC
WTVPSLGGFVYSLAFSPVDTGCLAIGVGDSMIRVWNTLSISNTYDVKTYWQGIKAKVTAL
SWHLTKEGCLAFGTDDGKVGIYDTYSGSTKNKPPQISSTYHKKTVYTLAWGPPVPPLSFG
GDGDKPSLTLYSCAGEGIVLQHNPWKLNGEATDINKVIKDTNSIKHKMPARAEISWKPDG
KILALGNEDGSIEIFQAPNLKLLCTIQQHHKLINAICWHHEHGTQPELSYLIASGSTNAV
IYVQNLKSIIESPPETPPTITEPFRTLAGHTAKITSLSWSPHHEGRLVSACYDGTAQVWD
VLKEEPLSNYRGHRGRLLCVQWSPVDPDSVYTGGDDFCVHKWLVSKQEHSHPPKGKKGIE
LEKKRSFQPKLKAKKKKKLVGKSPAKQDVNEAVNGDESIKECALDENEMSDHEAEKEAQE
QELSDRVSPTVAKEVPLHPSAASVPDLMKPFMNHRATPMKKEQPKEKPAPDTSLKKRKPR
SLLPVSTSLDHRSKDELHQDCLMLATCLNAKGNLGKDLVPDSDHVHLGLFADRAALYKML
EVEGRNHLENGHPELFQQLMLWKGDLKGTLQSAAERGELTDQLVAISPMAGYQAWVWTVE
AYAKQLCFQEQYIKAASHLLSIHKVYEAVELLKANHSYREAIVIAKARLRPEDPVLKDLY
TTWAANLEEDGHYSMAAKCYLGAASSYDAVKVLAKKGDVASLKAAAELALRAGEKDLSTT
LSLRCAQELVSARNWVGAQEVLQRQGSLLGQRLVFCLHELLCKCLSERNLAERKSSSLPC
YHSWDVRDKDSFLEMVTEVWQSVFGVSTVDQARTMWEQLHGILYPPATTNTHPKQLLFHI
AHDLTLAVLSYQTASWEEAVTALLSAVTRSCDAGNFTLLQEICSLLLPEGCDDLRHKLDS
TSCRSMAAHKSLEGFLAYGQLYDLWWNLPTDSPVSKQMVPESVSCPSEQAAPEQNAVSGI
FAEGMAPELEEHPPSMPASCPGPCAADSGDRTERQLKVNRCKVLLSEEIAALQNTQKDIA
KIQDTLADMIRQHQRNSLQESKLQPSPESESDKPIPPGSQSPGKAAAKEPVSLPELSKQL
AEAKQQLAEFPDSLKAFPFPDVLECSLVFLHIHSQSHSDVSPELRHQALDLLQKFTRDGE
YEKICGKFLT
NT seq 4533 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagcggctcctgcccgcctcgcccaactggtacctcagccgctgcagcgac
gcgagcgccggcgcgcggctcttcggcttcgcggcccggaacagcgtctacctgctgcgg
gtcagcgcccagcccgccttccacggagagctcatcggtcatacagaaagggtttctgga
tttaccttttgtcatttccctgatcagaccaacctctgcgcgagcagctcagatgatgga
accgtgaaaatctgggatactcagactctgtctcttgtaactgagcatacgctccatcag
aatacaatctcagccttgcattggtcaccccttgtgaaagatctggttgtgtctggtgat
gagagaggcatcatcgtttgttattggcataacagaaatgacagccaacagttcttccct
gagcctaggaccatcttctgcctcacgtgttcccctcaccaggagaatctggtagctatt
ggttacaaggatggcatggtggttataattgacatcagcaggaaaaaagaaattgttcat
cgcctgagaggtcatgatgatgaaatacactccttggcatggtgtcctgtgcccaatgaa
gaaggattatatagttggcaagaagagcttcaagcaggtgaggttccaaatggggagcta
acacaggaggcagctgtagcaaaaggttgttacctggcttcaggaagcaaagatcagacc
atccggatctggagctgtgctagaggcagaggggtgattactctgaagttgccctctgtg
aagagaagaagtggggcagttgatcctgctgttaaagagcgtatttggctgactgttcac
tggccaagtgaccatcccatggagctcatgtccagctgctttggaggtgaactgctgctg
tgggatttggcccaatcgggaaaacgcaagtggacacttttaggatcttccgaagggcaa
aatcactcgcggatcgtgttcaatctgtgctcgcttcgagtgcagggccgagagttgctc
ttttccatttcaatggacagagatgtgaagtgttgggacctagcaacactagactgttgc
tggactgtgccatctcttggagggtttgtctacagcctagccttctcccctgtggacact
ggctgcctggccataggggttggggacagcatgatccgggtgtggaatactctgtccata
agcaacacctatgatgtgaaaacatactggcagggcatcaaagccaaggtcacagcttta
tcctggcacctgacgaaggaaggctgtttagcctttggaacagacgatggaaaagttggt
atatatgacacctactccggcagcaccaagaacaagcctcctcaaatctccagcacctat
cacaagaagactgtgtatacgttagcctgggggcctccagttcctcccctgtctttcgga
ggtgatggtgacaagccctctctaacattgtacagctgtgctggagaaggtatcgtgttg
cagcacaacccttggaagcttaatggagaagcaaccgacataaataaagtaatcaaagac
actaactcgatcaaacacaaaatgcctgctcgcgctgagatcagctggaaaccagatggc
aaaatcttggcacttggtaatgaggatggatcaattgaaatatttcaggctccaaacttg
aaactgctctgtaccatccagcagcatcataaactgattaatgccatttgctggcaccat
gagcatgggacccagccagagctgagctacttgattgcctcgggttcaaccaatgctgtc
atttatgtgcaaaacctgaagagcatcatagagagccctccagaaactcctccgacaata
acggagccttttcgcactctggcgggacacactgctaaaatcacaagtctgtcttggagt
ccacaccatgaagggaggctggtatccgcttgctacgatggcactgcacaggtgtgggat
gttctgaaggaggagcctctgtccaattaccgagggcatcggggccggctgctctgtgtt
cagtggtccccagtggatccagattcagtgtatacagggggagatgacttttgtgtgcac
aaatggctcgtctcaaagcaagagcacagccaccccccaaaaggaaaaaaaggcatagag
ctggagaagaaaaggagctttcaacccaaactcaaagccaaaaagaagaaaaagctggtg
ggaaagagtccagcaaagcaggatgtgaatgaggcagtaaatggtgacgaaagcataaag
gagtgcgcgttggatgagaatgaaatgtcagaccatgaggctgaaaaggaagcccaggag
caggagctgtcagacagagtctcaccaacagttgccaaagaagttcccttgcatccatct
gctgcctctgtccctgacctgatgaaacctttcatgaaccatagagccaccccaatgaag
aaggaacaacctaaagagaaaccagctcctgatacctctctgaagaaaagaaagcctcgc
tcccttctgcctgtcagcacctctctggatcatagatcaaaggatgaattgcaccaggac
tgcttgatgctggctacgtgtctgaacgccaaaggaaatctggggaaagacttggttcct
gactcagatcatgtccatctggggctgtttgcagacagagctgctctgtacaagatgctg
gaggtggaaggaagaaaccacttggagaatgggcacccagagttgtttcagcagctcatg
ttgtggaaaggagacctgaagggcaccctccagtcagctgctgagcgtggggagctaacg
gaccagctggtggccatctcacccatggctggatatcaagcctgggtgtggacggtagaa
gcctatgcaaaacaactgtgcttccaagaacagtacatcaaggctgcctcgcatctcctt
tcaatccacaaggtgtacgaggctgtggagctgctgaaagcgaaccattcgtacagggaa
gcaattgtaattgccaaggccaggctgcgtccagaagatccagtcctgaaggatctctac
accacctgggcagcgaacttggaggaagatggccattattccatggcagccaaatgttac
ctgggagctgcatcttcctatgatgcagtgaaagtgctggcaaaaaaaggggatgtggca
tccctaaaagctgctgcggagctcgctctgagagctggggagaaggatctgtcaaccacg
ttatctctcagatgtgcccaggagttggtgtctgccaggaactgggttggagcacaggag
gtccttcagcggcagggaagcctactgggacagaggctagttttttgccttcatgaactg
ctttgcaagtgcctcagtgaaagaaatctagctgagcggaagagctcctccctgccctgt
taccacagctgggatgtgagggacaaagactccttccttgagatggtgactgaggtgtgg
cagagcgtgtttggagtgagcaccgtggatcaggccaggaccatgtgggagcagctgcat
ggtattttgtatcctcccgctaccaccaacacccatcccaagcagctgctcttccacatc
gcccacgatctgaccctggcagtgctgagctaccagactgcttcgtgggaggaggcagtg
acagctcttctcagtgccgtgacccgcagctgtgatgctggcaacttcactcttctgcaa
gaaatctgcagcctcctccttcccgaaggctgcgatgacctgaggcacaaactggacagc
acgagctgtcggagcatggcagctcacaagagtttagaaggcttcctggcttacggacag
ctgtatgatctgtggtggaacctgcccacagactcccccgtctccaaacagatggtgcca
gagtctgtgtcttgccctagtgagcaggcagctcctgaacagaatgctgtctcgggcatc
tttgcggaaggaatggcacctgagctggaagaacatccccccagcatgcctgcttcctgc
cctgggccctgtgcagctgactcaggggatcgaacagagaggcagctgaaagtgaataga
tgtaaagtgctcctttctgaagagattgctgctttgcagaacacccagaaagacattgcc
aagatccaggacactctggcggacatgatccgccagcatcaaagaaacagcttgcaggag
agcaagctgcagcccagccccgagagtgagtcggacaagcccatccctccaggcagccag
agcccaggtaaagcagcagcaaaggaaccggtttcccttcctgagctgtcaaagcagctg
gcagaggccaagcagcaactggcagaatttccagacagtctaaaggccttcccattccca
gatgtgctggagtgcagcctggtgttccttcacatccactcccagagccacagcgacgtg
agtccggaactgcggcatcaggccttggacctgctgcagaagttcactcgagacggggag
tatgaaaagatctgcgggaagttcttaacgtga

DBGET integrated database retrieval system