KEGG   Alligator mississippiensis (American alligator): 102567889Help
Entry
102567889         CDS       T03087                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04020  Calcium signaling pathway
amj04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102567889 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102567889 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:amj04030]
    102567889 (HTR4)
G protein-coupled receptors [BR:amj04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    102567889 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Git3
Motif
Other DBs
NCBI-GeneID: 102567889
NCBI-ProteinID: XP_006277847
Position
Un
AA seq 387 aa AA seqDB search
MEELDVNVSSSERFNVAEKIALLTFISAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVENNWIYGEMFCLVRTSLDVLLTTASILHLCCIALDRYY
AICCQPLVYRNKMTPIRIAVMLGGCWVIPTFISFLPIMQGWNSIGIIDLIQQRQFNKASN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYITAREHARQIRILQRAGAPTDGRQ
HHPDQHSTHRMKTETKAAKTLCIIMGCFCLCWAPFFITNIVDPFINYTVPEQLWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCGDERYRRPSILGPAVPCSTTTINGSTHVLRY
TVLHNGHHQEHEKLPIHNDPESQESCF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacttgatgttaatgtgagttccagtgagagattcaacgtggcagagaagatt
gcactgctcacttttatctcagcagtcatactcatggccatcctggggaacttgctggtg
atggtggctgtatgcagagacaggcagctcaggaaaatcaagaccaactattttattgtc
tcacttgccttcgcggacctgctggtttcagtgctggtgatgccatttggagctattgaa
ctggttgagaataactggatttatggagagatgttctgcctggttcgaacatctctagat
gtcctcctcaccacagcatcaatccttcacctctgctgtattgcattagacaggtactat
gccatctgttgccagcctctggtttacaggaataagatgacgccaatacgcattgctgta
atgcttggagggtgctgggtaatcccgacatttatttcttttctccccataatgcaaggc
tggaatagcattggcataatagacttgatacaacaaaggcagttcaacaaggcttccaac
tcaacctactgcgtattcatggtcaacaagccgtatgccattacctgctcagtggtggcc
ttctacattcccttcctcctgatggtgctggcctactatcggatctacatcacagccagg
gagcatgcacgccagatccggatcctccagcgtgcaggagctcccacagatgggaggcag
caccatcctgaccagcatagtacccatcgtatgaagactgagaccaaagctgccaaaacc
ctgtgtatcatcatggggtgcttctgcctatgctgggctcccttctttattacaaacata
gtggaccctttcataaactacactgtgcccgagcagctgtggacagctttcctgtggttg
ggctacatcaattcagggttgaaccctttcctgtacgccttcttgaacaaatctttcaga
cgtgccttcctcatcattctatgttgtggtgatgaacgatatcgaaggccttccatcttg
ggtccagctgtcccctgttctaccaccactataaatggatcaacacatgtgctaaggtat
acagttttacacaatgggcatcatcaggaacatgagaagcttcccatccacaatgaccca
gaatcccaggagtcctgtttctaa

DBGET integrated database retrieval system