KEGG   Alligator mississippiensis (American alligator): 102568603Help
Entry
102568603         CDS       T03087                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy related 16 like 1
  KO
K17890  autophagy-related protein 16-1
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04136  Autophagy - other
amj04140  Autophagy - animal
amj04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102568603 (ATG16L1)
   04136 Autophagy - other
    102568603 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102568603 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:amj04131]
    102568603 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:amj03029]
    102568603 (ATG16L1)
Membrane trafficking [BR:amj04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    102568603 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    102568603 (ATG16L1)
Mitochondrial biogenesis [BR:amj03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    102568603 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 Ge1_WD40 eIF2A Fez1 V_ATPase_I Peptidase_M15_4 ComA WD40_like HTH_6 Allexi_40kDa
Motif
Other DBs
NCBI-GeneID: 102568603
NCBI-ProteinID: XP_006261857
UniProt: A0A151NTZ1
Position
Un
AA seq 607 aa AA seqDB search
MSAGLRAAAFPAWKRHIAEELRRRDRLQRQAFEEIILQYNKLLEKSDLHAVVADKLQAEK
QDLQSRHEISPGHDGTWSEAQLQELAQLRIKYQEELTELHKKRGELAQSVIDLNNQMQQK
DREMQLNEAKIAEYLQKISELETECQELHNKLQDLEQANQTLKDEYDALQITFNALEEKL
RKTTEDNQELVSRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLSVEQDDDI
EVLADETSDPAEETSPVRAVSRTSSKRFSQPTGGLLDSITNIFGRRSLSSFPIPQDNVET
HPVSSKEVRVPSTAVCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGDKCELKG
SLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVMSAKFLLDN
ARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKVRFWDIRSES
IVQELELLGRITALDLNPERTELLTCSRDDLLKIIDLRVNAVKQTFSAQGFKCGSDWTRV
VFSPDGTYVAAGSADGTLYIWNVLTGKVERALAKHHSSSINAVAWSPAGAHVVSVDKGNK
AVVWSEF
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcggggctgcgagccgccgccttccccgcttggaagcgccacatcgcggaggag
ctgcggcggcgggaccggctgcagaggcaggccttcgaggagatcatcctgcagtataac
aagctgctggagaagtcggatctccatgcagtggtggcagacaagctacaagcagaaaaa
caggatttgcaaagcaggcatgagatcagtccagggcatgatggtacatggagtgaagct
cagttgcaggaactggcccagctgagaattaagtatcaagaggagctgacggagctgcat
aagaaacgtggtgagttggcccagtctgtaatagatttgaataaccaaatgcagcagaaa
gaccgagagatgcagctgaatgaagcaaaaattgcagagtatttgcaaaagatctctgag
ctggaaacagagtgccaggagttacacaacaaactgcaggatcttgagcaagctaatcaa
acattgaaggatgagtatgatgcccttcagatcacctttaatgctctagaagagaaactg
aggaaaaccactgaagacaaccaagagctggtctcacgttggatggcagaaaaggctcag
gaagccaatcgtctcaatgcagaaaatgagaaagattcaaggagacggcaagccagactg
cagaaagaactggcagaagctgccaaagaacctctgtctgttgaacaggatgatgatatt
gaagtccttgcagatgaaacctctgacccagctgaggagacatccccagttcgagctgtg
agccggacttccagtaagcgattctcccagccaactggaggccttctggactctatcact
aatatctttgggaggcgctctctgtcctcattccccatcccccaagacaatgtagagacg
catccagtctccagcaaagaagtgagagtgcccagtactgctgtatgtgtttttgatgca
catgacggggaagtgaatgcagtgcagttcagtcctggctctcggttactagcaacagga
ggcatggaccggagggttaaactctgggaggtctttggagataagtgtgagctaaagggc
tccctctccggtagtaatgcaggaattacaagcatcgagtttgacagtgctggctcttac
cttttagcagcttcaaatgactttgccagcagaatctggacagttgatgactatcggtta
cggcacaccctgacaggtcacagtggtaaagtcatgtcagccaagtttttgttggacaat
gcgcgtattgtttctgggagccatgaccggaccctcaagctttgggacctgcgcagcaaa
gtttgtataaaaacagtgtttgcaggatctagctgcaatgatatagtctgcactgagcag
tgtgtaatgagtggacattttgacaagaaagttcgcttctgggacataaggtctgaaagc
atagtacaggagttggaactgcttgggaggatcactgctttggacctgaatccagagaga
acagagctcttaacctgttcccgagacgacttgctgaagatcattgatctacgggttaat
gctgtcaaacagaccttcagcgcccagggattcaaatgcggatctgactggaccagagtt
gtattcagccctgatggcacctatgtggcagctggttcagctgatgggaccctgtacatt
tggaatgtgctcactgggaaggtggagagagctcttgcaaagcatcacagctcctctatc
aacgcagtggcatggtcaccagccggtgctcatgtggtcagtgtggacaaaggaaacaag
gctgtcgtgtggtctgaattttga

DBGET integrated database retrieval system