KEGG   Alligator mississippiensis (American alligator): 102569403Help
Entry
102569403         CDS       T03087                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 3-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00071  Fatty acid degradation
amj00592  alpha-Linolenic acid metabolism
amj01040  Biosynthesis of unsaturated fatty acids
amj01100  Metabolic pathways
amj01212  Fatty acid metabolism
amj03320  PPAR signaling pathway
amj04146  Peroxisome
Module
amj_M00087  beta-Oxidation
amj_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102569403
   00592 alpha-Linolenic acid metabolism
    102569403
   01040 Biosynthesis of unsaturated fatty acids
    102569403
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102569403
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102569403
Enzymes [BR:amj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     102569403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_2 DUF2703 SAM_Ste50p
Motif
Other DBs
NCBI-GeneID: 102569403
NCBI-ProteinID: XP_014463139
Position
Un
AA seq 752 aa AA seqDB search
MARPGPAPSRLFPGRGVAVSPSTSCSCRRRRAEVLSLKMATTTDLKEASGTQNSGDILLP
DFPKGPLCVYRKKASFNWKEMAVFLEGKELLQYKNGIFSTLENDPLFARHHGEDITQEKL
RELTFLRCKKLFEYEFVNMEDLIVNPLKLMILLQCLGMYDWSVCLKYLLNHQNFKNMIES
AGSERHKELVRQVDNMEIFGCFALTELSHGTNTKAIRTTARYDPSTQEFVINTPDFEAAK
FWIGNMGKNATHAVVYAQLYTSDGKCHGLHTFVVQNICYKNCDCMDIFSFSFPADNLFHS
SSYYEYISLDRFAMFHKVRIPKENLLNNTGDVTEEGVYTSSFKDLKHRLGASLGSLSVGR
ICIVQMSVANLKLALSIAIRFSATRHQFGPTDGEEIPVLEYQMQQWRLLPYLAASYALDH
FVKTLFMNFVEFKIGVVMKEKSLRQAELGRELHALAAAGKPLASWTAQQAAQECREACGG
HGYLSINRLGDIRNENDPNCTYEGDNNVLLQQTSNYLLSWVTVKHQDKAPIESPFGTVNF
LEDYHYILSQKFTASSAEDCMNSSVPLAAYKWLVCYLLQESDLKLNQKKQSGCSDFEARN
NSQVYYCRSLAIAFIEHTVLQRYHDYTHDPTTPSTLQPVLKQLSALYGLWSLSKHMAVLY
QGGYISGEQPSRFIQNAILELCSKLKDDAVALVDVIAPPDFILNSPIGRSDGELYKNLWN
AVLQGSEVLQRPSWWAEFCTNKPNVGRLRSRL
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggcccggcctggccccgccccctcacgtctatttccggggcggggcgtcgccgtttcc
cctagcacttcctgcagctgccgccgtcgccgggcagaagtgcttagcttgaaaatggca
accaccactgacctgaaggaagctagtggtacccaaaactctggggacattttgctgcca
gacttccctaagggaccactttgtgtgtaccgcaagaaggcttccttcaactggaaagag
atggcagtgtttttagagggaaaagaactcctccaatataagaatggaatcttctctact
ttggaaaatgatccactctttgctcgtcatcatggagaagatataacccaagagaaactt
cgtgagctgacattcctgcgttgcaagaagctctttgaatatgagtttgtaaatatggaa
gatctcatagtgaatccattaaaacttatgatattgttacagtgccttgggatgtatgat
tggtctgtctgtctcaaatacctcttaaatcaccaaaatttcaagaatatgatcgaaagt
gctggatctgagaggcataaggaattggtgagacaagtcgataatatggagatttttgga
tgttttgctctgactgaacttagccatggaaccaatacaaaggctatccggacaactgcc
cgatatgaccccagtactcaggaatttgtcatcaacactccagattttgaagctgccaag
ttttggattggtaacatgggaaaaaatgctactcatgcagttgtgtatgcccagctctat
acttctgatggaaaatgccatggattgcatacttttgttgtacagaacatttgctacaag
aactgtgattgtatggatatattttctttttcttttcctgctgataatcttttccattcc
agttcatattatgaatatatttctttggacagatttgccatgtttcacaaggtcaggata
cctaaagaaaacttactgaataatactggagatgtcacagaggagggagtatacacaagc
tcatttaaggatctcaaacatcgtcttggtgcctctcttgggtctttatccgttggcaga
atttgtatagtacaaatgtctgttgctaatttaaagctcgctttatcgatagctattcgt
ttctctgcaacacgccatcaatttgggccaacagatggtgaagaaataccagtccttgaa
taccaaatgcagcaatggcgccttcttccctatctggcagctagctatgccttagaccat
tttgtcaagactttgttcatgaactttgtagaatttaaaataggtgttgtgatgaaggaa
aagagcctaagacaggctgaacttggacgtgaacttcatgctttggctgctgctggcaaa
ccactggcctcctggactgcacagcaggcagcccaggagtgtcgagaagcttgtggagga
catggctacctatccataaatcgtctaggtgatatccgcaatgagaatgatccaaactgc
acatacgaaggagacaataatgtcctgcttcagcaaactagcaactacttgttgagttgg
gtgactgtgaaacaccaagataaagcacctattgaatccccttttggaacagtaaacttt
ttggaagattaccattatattctgagccaaaaatttacagcctctagtgctgaagattgc
atgaactcttcagttcctttagcagcctacaaatggctggtgtgttacctactccaagaa
agtgacctaaagttgaaccagaaaaaacagtctggatgtagtgattttgaggcgagaaac
aacagccaggtatactactgtcgttcattagctatagcttttattgagcatacagtctta
caaagataccatgattacactcatgatcccaccacaccatctactctccagcctgtacta
aagcaactcagtgctctctatggactatggtctttaagtaaacatatggctgtgctctat
caaggtggatatatttcaggtgaacaacctagtaggttcatccaaaatgctattctggaa
ctttgctccaagttgaaagatgatgctgttgccttggtcgatgtcattgctcctcctgac
ttcattctgaactcacccattggcagatctgatggagagctatataaaaatctctggaat
gcagtcttgcaaggcagtgaagtcctgcagagaccatcatggtgggcagaattttgtacc
aataagcccaatgtaggcaggctgagatcaagactataa

DBGET integrated database retrieval system