KEGG   Alligator mississippiensis (American alligator): 102569481Help
Entry
102569481         CDS       T03087                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj03040  Spliceosome
amj04010  MAPK signaling pathway
amj04141  Protein processing in endoplasmic reticulum
amj04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:amj00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102569481
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102569481
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102569481
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102569481
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:amj01009]
    102569481
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:amj03041]
    102569481
   03009 Ribosome biogenesis [BR:amj03009]
    102569481
   03110 Chaperones and folding catalysts [BR:amj03110]
    102569481
   04131 Membrane trafficking [BR:amj04131]
    102569481
   03051 Proteasome [BR:amj03051]
    102569481
   03029 Mitochondrial biogenesis [BR:amj03029]
    102569481
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amj04147]
    102569481
Protein phosphatases and associated proteins [BR:amj01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     102569481
Spliceosome [BR:amj03041]
 Complex B
  Other components
   Prp19 complex
    102569481
 Complex C
   Prp19-CDC5 complex
    102569481
Ribosome biogenesis [BR:amj03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    102569481
Chaperones and folding catalysts [BR:amj03110]
 Heat shock proteins
  HSP70 / DNAK
   102569481
Membrane trafficking [BR:amj04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    102569481
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    102569481
Proteasome [BR:amj03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    102569481
Mitochondrial biogenesis [BR:amj03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    102569481
Exosome [BR:amj04147]
 Exosomal proteins
  Proteins found in most exosomes
   102569481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA RGM_C
Motif
Other DBs
NCBI-GeneID: 102569481
NCBI-ProteinID: XP_014460459
UniProt: A0A151NFS8
Position
Un
AA seq 650 aa AA seqDB search
MQKRSPPPALKRPAIGIDLGTTKSRVALFRDGTVEIIRDDQGARAVPSCVAFTETGRTTG
EEAKNRAALNAPNTVFSAKRLLGRSSEDPAVRAEVAFWPFQVVRAKEKPRVQVSYQGEEK
AFFPEEISAMVLGHLKEMAEAYVGLPVTHAVITVPPHFNDSQRQATKDAATIAGLNAVRI
LNETTAAALAYGLDNPSSSARNGLIFDLGGGSFSVSVFTMHGGIIEVRATAGDTCLGGDD
FDNRLVSFFVDDFFKKHRENIGRDRRAVWRLRMACEEAKRLLSSNGKASVRLDDLYEGIG
FHADITRAQFEELCAGLFQRTLELVDRALQDAGLSQAQIHDVILVGASTRIPKIQQLLQD
FFAGRQLNRSLNPEEAVVSGAAVQAAILMQDKSQVTRSLLALDIASLSLGIEAGIGKMHT
LIKRRSAVPVVVTRTFTTFDDQQPDLIIRAYEGEGATTKENHLLGSFLLKGLCPVPHGML
LLEVTFYINTDGILTVFARDKASSNASAIAVDARKGRLSRDELQKLAADHEKYRAEDRAQ
KWKLVTKNYLQSCVFSVKRTSEDVLCYLTLQAKKKMVEKCQQAFSWLSPARWLKKRRSGP
MKMVSGPSVSGLKSLGSSTAGINRKRPNKFVVTTCSWTVQFTQTTTVIYP
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagcggtcacccccgcccgcgctgaaacgacccgcgattggcatcgatttgggt
accacgaaatcccgcgtggcgctctttcgggacggcacggtagaaataatccgcgacgac
cagggcgcccgcgccgtgcccagctgcgtggctttcaccgagaccgggaggacgacggga
gaggaggctaagaaccgggcggccctcaacgcgccgaacaccgtattcagcgccaagcgg
ttgcttggccgcagctccgaggatccagctgtgcgggcagaggtggccttctggcctttc
caggtcgtgagagcgaaggagaagccccgggtgcaagtgtcttaccagggcgaggagaag
gcttttttccccgaggagatctctgccatggtgctgggccacctaaaggagatggcggag
gcttacgtgggacttcccgtcacccacgccgttatcacggtgccgccgcacttcaacgac
tcccagcgccaggccaccaaagacgctgcaaccattgctggcctcaacgcagtgaggatc
ctcaacgagacgacggcagctgccctggcctacggcttagacaaccctagcagcagcgca
cgcaacgggctcatctttgacttgggtggaggatccttcagcgtctccgttttcaccatg
catgggggcatcattgaggtgagggccacggcgggggacacctgcctcggcggagatgat
ttcgataaccgcctagtgagcttcttcgtagatgacttctttaaaaagcatcgggagaac
atcggccgggacaggagagctgtatggaggctcaggatggcctgcgaggaagccaagcgc
ttgctgtcttccaacgggaaagccagcgtccgcctggacgacctgtacgaagggattggc
ttccatgcagacatcacccgggcccagtttgaggagctgtgtgccggcctcttccagagg
actctggagcttgtagacagggcgctgcaggatgcaggtctaagccaagcccagatccac
gatgtgatcctggtcggcgcctccacccgcatccccaagatccagcagctgctccaggat
ttctttgcaggccggcagctgaatagaagccttaatccggaggaagccgtggtctctggg
gcagctgtccaggctgccatcctcatgcaggacaagtcacaggtcacccggagcttgctt
gccttggatatagcatccctgtccctggggatcgaggcaggcatagggaagatgcacacc
ctgatcaaacgccgctcggccgtccctgtcgtggtcacccggaccttcaccacgtttgac
gaccagcagcctgacctcatcatccgagcctatgaaggggagggggcaaccaccaaggaa
aaccacctccttggctctttcctcttgaagggcctttgccctgtccctcacggcatgctg
ttgttggaggtgaccttctacatcaacacggatggcatcctgacagtgtttgcccgggac
aaggcttctagcaacgctagcgcgatcgctgttgatgcccgtaaggggcggctgagcagg
gacgagctgcagaagctagcagcggaccatgagaaataccgagcagaagacagggcgcag
aagtggaagctggtcaccaagaattacctccagtcctgcgttttcagcgtgaagcggacc
tcggaagacgtcctgtgctacctcaccttgcaagccaagaagaagatggtggagaagtgc
cagcaggctttctcctggctgagtccagccagatggctgaaaaagaggaggtcagggcca
atgaagatggtctcgggaccatcggtgtcgggactgaagtccctcggtagtagcacagca
gggatcaacaggaaaaggccgaataagtttgtggtcaccacttgcagctggaccgtccag
tttacccaaaccaccactgtgatctacccttag

DBGET integrated database retrieval system