KEGG   Alligator mississippiensis (American alligator): 102569677Help
Entry
102569677         CDS       T03087                                 

Gene name
CPT2
Definition
(RefSeq) carnitine palmitoyltransferase 2
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00071  Fatty acid degradation
amj01212  Fatty acid metabolism
amj03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102569677 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102569677 (CPT2)
Enzymes [BR:amj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102569677 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 102569677
NCBI-ProteinID: XP_006259675
Position
Un
AA seq 654 aa AA seqDB search
MIEMIIQLLVAARRLPPAPGLRGAHRAADFLQRSVVPTLHYQRSLPRLPIPKLEDSVRRY
LNAQKPLLDDDQFRKTEEIARRFESGIGRELHKQLVAQDKQNKHTSYISGPWFDMYLRAR
ESVVLNFNPFMAFNPDPKAEYNDQLTRATNMTVSALRFLKTLRAGYLEPEVFHLNPAKSD
TEMFKKLIRFVPSSLSWYGAYMVNAYPLDMSQYFRLFNSTRLPKFNRDELFTDEKAKHLL
VLRNGNFYVFNVIDGDGNIVKPSEIQAHLKYILSDSSAAPAFPLSYLTSENRDVWAGLRQ
KLLDNGNEEALHKVDSALFCLCLDDFPIKDLEHLSHVMLHGDGTNRWYDKSFNLIITKDG
TSAIHFEHSWGDGVAVVRFQNEVFKDSTQAPAVSPQSQPAAVDSSQAVQKLDFNLNDALK
TGIAKAKEQFDAAVKSLTLDSIQFEKGGKELLKQKKVSPDAVAQLSFQMAFLRQNGQTVA
TYESCSTAAFKHGRTETIRPASIYTKKCSDAFLREPSKYSIEDLQRMIMECSKYHSQLTK
EAAMGQGFDRHLFSLSYLAMSKGMPLPDFYQDQAYVQLNHNILSTSTLTSPAVQFGGFAP
VVPNGFGVGYAVHDNWVGCNVSAYPARNVKEFLQCVRQSLEDIFCVLEGKHISK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatgatcatccagctgctggtcgctgcccgccggctgccgcccgcccccggc
ctgcgcggggcccaccgcgccgccgacttcctgcagcgcagcgtcgtgcccaccctgcac
taccagcgcagcctgccgcggttgccaattcccaaacttgaagatagtgttagaagatac
ctgaacgcccagaagcctctcttagatgatgaccaattcaggaaaacggaagaaatcgct
cgccgctttgaaagtggaattggaagagaactgcacaagcagctagttgcccaagacaag
cagaacaaacacactagttacatctcaggtccctggtttgatatgtatctaagggcacgt
gagtctgtagttttgaattttaatccatttatggctttcaatcctgaccccaaagctgaa
tataatgaccagctgacacgagcaactaacatgactgtttctgccctccgtttcttgaag
accctcagagctggctacctagagccagaggtttttcaccttaatccagccaaaagtgac
acagagatgtttaaaaagctcattcgatttgtgccatcgtccctttcctggtatggtgcc
tacatggtcaatgcttatcccctagatatgtctcagtatttcaggcttttcaattccaca
cggctgccgaagttcaatagagatgagcttttcacagatgaaaaggcaaaacacttactt
gtgctcagaaatgggaatttttatgttttcaatgtcattgacggagatgggaacattgtg
aaaccttcagaaatccaagcacacctaaaatacattctttctgatagcagtgcagcccca
gccttccctcttagttatctaaccagtgaaaacagagacgtgtgggcaggactgaggcag
aagctacttgataatggcaatgaagaagcccttcacaaagtggactctgctctcttctgt
ctgtgtctggatgatttccccattaaagaccttgaacacttgtcccatgtcatgctgcat
ggagatggtactaatcgctggtatgacaaatccttcaaccttattataaccaaagatggc
acttcagccattcattttgagcactcttggggagatggggtggctgtggtgagattccag
aacgaggtgtttaaagacagcacccaggcacccgctgttagtccacagtctcaacctgct
gctgttgactcttcccaagctgtgcagaaacttgattttaacctgaatgatgccttaaaa
acaggaattgccaaagccaaagaacagtttgatgctgctgtgaaaagcctgactcttgac
agtattcagtttgagaaaggaggcaaggagcttttaaagcagaagaaggtaagtcctgat
gctgtggctcagctctccttccagatggctttcctccggcagaatggccagacggtcgcc
acatacgagtcttgtagcactgcagctttcaaacatggtcgcacggagaccatccgtcct
gcctccatctacacaaagaagtgttcagatgctttcctcagggaaccttccaaatacagc
atagaagatcttcaacggatgatcatggagtgctccaagtaccacagccagttgacaaaa
gaagctgctatgggtcaaggatttgaccggcacctgtttagcttgagctatttggcaatg
tccaaaggtatgccattgcctgacttctaccaggaccaagcttatgttcagctgaaccac
aacattctctctacaagcactttgaccagccctgctgtgcagtttggaggatttgcgccc
gtggtgcctaatggctttggtgtaggatatgcagtacatgataactgggttggttgcaat
gtttctgcttacccagccaggaatgtgaaagaattcctccagtgtgtgcgtcagtcacta
gaggatattttctgtgttttggaaggcaagcatatcagtaaatag

DBGET integrated database retrieval system