KEGG   Alligator mississippiensis (American alligator): 102570011Help
Entry
102570011         CDS       T03087                                 

Gene name
PPIC
Definition
(RefSeq) peptidylprolyl isomerase C
  KO
K09563  peptidyl-prolyl isomerase C (cyclophilin C) [EC:5.2.1.8]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:amj03110]
    102570011 (PPIC)
Enzymes [BR:amj01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     102570011 (PPIC)
Chaperones and folding catalysts [BR:amj03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    102570011 (PPIC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase DUF3271
Motif
Other DBs
NCBI-GeneID: 102570011
NCBI-ProteinID: XP_006264518
Position
Un
AA seq 204 aa AA seqDB search
MDLRGIASANMCSLRVHMYKENVLRKNFEEHVFFDVKIGERDVGRIVIGLFGKVVPKTVE
NFIALATGEKGYGYKGSKFHRVIKDFVIQGGDFTVGDGTGGRSIYGEQFPDENFKLKHYG
IGWVSMANAGPDTNGSQFFITVTKPSWLDGKHVVFGKVIDGMSVVHSIELLQTDEHDRPL
EDCVIVNSGKIAVKEPFVVEVDDW
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggacttgcgtggcatagcatctgccaatatgtgcagtttaagagtacacatgtacaaa
gaaaatgttctacgaaagaactttgaagaacacgtgttctttgatgtgaagattggagag
agagacgttggcagaattgtaatcggattgtttggaaaagttgtcccaaagactgttgag
aacttcattgctttggcaactggtgaaaaaggatatgggtacaaaggaagtaagtttcat
cgcgtgatcaaagattttgtgattcaaggtggagattttacagttggagatggaactgga
ggaagaagtatttatggagagcagtttccagatgagaactttaaactcaagcactatggt
attgggtgggtcagcatggctaatgctggcccagatactaatggttcccagttcttcatc
acagtgacaaaaccttcctggttagatggaaaacacgtagtttttggcaaagtcattgat
ggaatgtctgtcgtacactctatagaacttctgcagacagatgaacatgatcgccctctt
gaagactgtgtgatagtaaacagcggcaaaatagctgtgaaagaaccatttgtggttgaa
gtagatgactggtga

DBGET integrated database retrieval system