KEGG   Alligator mississippiensis (American alligator): 102570036Help
Entry
102570036         CDS       T03087                                 

Gene name
PLA2G4C
Definition
(RefSeq) phospholipase A2 group IVC
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00564  Glycerophospholipid metabolism
amj00565  Ether lipid metabolism
amj00590  Arachidonic acid metabolism
amj00591  Linoleic acid metabolism
amj00592  alpha-Linolenic acid metabolism
amj01100  Metabolic pathways
amj04010  MAPK signaling pathway
amj04217  Necroptosis
amj04270  Vascular smooth muscle contraction
amj04370  VEGF signaling pathway
amj04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102570036 (PLA2G4C)
   00565 Ether lipid metabolism
    102570036 (PLA2G4C)
   00590 Arachidonic acid metabolism
    102570036 (PLA2G4C)
   00591 Linoleic acid metabolism
    102570036 (PLA2G4C)
   00592 alpha-Linolenic acid metabolism
    102570036 (PLA2G4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102570036 (PLA2G4C)
   04370 VEGF signaling pathway
    102570036 (PLA2G4C)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102570036 (PLA2G4C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102570036 (PLA2G4C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102570036 (PLA2G4C)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102570036 (PLA2G4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 102570036
NCBI-ProteinID: XP_019355960
UniProt: A0A151MHR9
Position
Un
AA seq 499 aa AA seqDB search
MSTVSDEKVRLSHDLSEGEKVAIGLRKAKVMKCLESLGMHCDQDNIPNITLLASGGALRA
MVSLQGTLVEMKQQGLLDAILYLYGVSGSTWCMSYLYKDREWTEHLQDLEKKLCQTLVES
SWDKNKAISTVVEASKEEHYSLTDFWVSFMIYKILHKFDESGLSEQKTSLESGKNPYPIY
AAADNKRLNKGHESLPETWFEFTPHEAGYPAVGAFINTSLFGSDFENGELKVKKKEKTIC
YLEGLWGSALGNIKEIKKLLQESLTEFFKGSGEKEKDHVSPNPESPNVHFTAVEEKERSA
ISLFFAPVLDAHRVTTKTAACLLSWTWGTTSNFLYKCPNIKSTDMVKDKVTSFIDAGLAI
NSAYPLALRPERKVKLILSFDFSSGDPFETIKKTVKYCQANKIPFPKVDEEKLKDTDNPS
DCYIFTGVNVPTVMHFPLFNNINCSGKIADYRKKYSTFTSSYPKEDIQELLKVAKMNVTN
NAQKILEEIKQLVASSTNP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagtgagtgatgaaaaagtccgtctttcccatgatctctccgagggtgagaaa
gtagccattgggctcagaaaggcaaaagtgatgaagtgtttggaaagccttgggatgcac
tgtgaccaggataacataccaaatattaccttgttggcatcaggtggagctctgcgggcc
atggtatccttacagggtacattagtggagatgaagcaacagggtctactggatgccatc
ctgtacctgtatggtgtgtccggttccacctggtgcatgtcctacctgtacaaggatagg
gagtggacagaacatttgcaggacttggaaaaaaaactgtgtcaaacattagtcgaatcc
tcctgggacaaaaataaagcaataagcacagttgtggaggcatcaaaggaagaacattac
tccctgactgatttctgggtttcctttatgatctataaaatattgcataagtttgatgaa
agtgggttatctgaacaaaagacttccttagaaagtgggaaaaacccttatcctatctat
gctgctgcagataataaaagattgaacaaaggacatgaaagcctcccagagacctggttt
gaatttacccctcatgaagctggctatcctgctgtaggagcatttataaacaccagtcta
tttggaagtgactttgagaatggagagttaaaagtaaagaaaaaggagaaaaccatctgc
tacttggaaggcttatggggaagtgcacttggaaacataaaggaaattaaaaaactatta
caagaaagtctgactgaattctttaaaggatcaggggagaaagaaaaagatcatgtttca
ccaaatcctgagagtccaaatgtacactttacagcagttgaggagaaagaaagaagcgcc
atttcactgtttttcgctccagttttggatgcccatcgggtgacaacaaaaacagcagcg
tgtctactcagctggacatggggaaccaccagcaacttcctttacaaatgccctaatatt
aagtccactgacatggtcaaagacaaagtcacctcctttattgatgccggccttgccata
aactctgcctatcctctggctcttcggccagagaggaaagtaaaattgatcctctccttt
gatttcagctctggagatccttttgagaccatcaagaaaacagttaaatattgccaggca
aacaagatcccctttcccaaagtcgatgaagaaaaactgaaggatactgataacccatct
gactgctacatcttcacaggtgttaatgtgcctactgttatgcacttcccactcttcaac
aacatcaactgttctggtaaaattgctgactacagaaagaaatattctacctttacttca
tcctacccaaaggaagacatccaagagctcctcaaagtagcaaaaatgaatgtgactaac
aatgcacagaagattttggaggaaatcaagcagcttgtggcttcatctaccaacccgtaa

DBGET integrated database retrieval system