KEGG   Alligator mississippiensis (American alligator): 102570250Help
Entry
102570250         CDS       T03087                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  arginase [EC:3.5.3.1]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00220  Arginine biosynthesis
amj00330  Arginine and proline metabolism
amj01100  Metabolic pathways
amj01230  Biosynthesis of amino acids
Module
amj_M00029  Urea cycle
amj_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102570250 (ARG2)
   00330 Arginine and proline metabolism
    102570250 (ARG2)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     102570250 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 102570250
NCBI-ProteinID: XP_019332578
Position
Un
AA seq 356 aa AA seqDB search
MSLRSGFARLLRKQADAALQVPKPGHSVALVGAPLSRGQKRRGVEHGPGAIRGAGLTQRL
LGLGCRVYDFGDLNFTQVPNDELYNNLVKYPRSVGLASQVLADAVSGAVAAGHSCVTIGG
DHSLALGAISGHTRQCPHLCVIWVDAHADVNTPLTTQSGNLHGQPVSFLLRELQDKMPQL
PGFSWLKPCLSAPDIVYIGLRDVDPAEYYILKNYDIQYFSMRDIDRLGIQKVMERTSEHL
MGRRQRPIHLSFDIDAFDPSLAPATGTPVLGGLTYREGMYIAEEIHNTGMLSAIDLVEVN
PLLGASQEEVKATASLAVDVIATCFGQTREGAHTVFDELPTPSSPDESESEEQVRI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcgcagcggcttcgcgcggctcctccgcaagcaggcggacgcggcgctgcag
gtgccgaagcccgggcactcagtggcgctggtcggcgcccccttgtcccggggccagaag
cggcgcggcgtggagcacggccccggcgccatccgcggcgcggggctcacgcagcggctc
ctcggcctgggctgccgagtatatgattttggagatctgaattttactcaggtgcctaat
gatgagctgtacaacaacctggtaaaatacccacggtctgtgggattagccagccaagtg
ctggctgatgctgtaagtggagcagtggctgctgggcacagctgtgtaaccataggaggt
gaccacagcttggcgcttggtgccattagtggccatacacgacagtgcccacacctctgt
gtgatctgggtggacgcacatgcggatgtcaataccccactcacaacccagtctggaaac
ctccatggacaaccagtctcatttctcttacgagagctccaggataaaatgccacagctt
cctgggttttcctggctaaagccttgcctctcagcacctgatattgtatacataggtctg
agggatgtggatcctgctgaatactatattttgaagaactatgacatccaatatttctca
atgagggatattgatcgccttggaatccagaaagttatggaaagaacatctgaacacctg
atgggcaggagacaaagaccaattcacctcagctttgacattgatgcttttgatccttca
ctggctccagcaacaggaacccctgttttaggtggattaacatatcgggaaggcatgtat
attgcagaggaaatacacaatacaggaatgctttcagcaattgacctggtagaagtaaac
ccactgcttggagcctctcaggaggaagtgaaggctacagccagtcttgcagtagatgtg
attgcaacatgctttgggcaaacaagggaaggggcacatactgtttttgatgaactccca
acacctagttcaccagatgaatcagaaagtgaagagcaagtgaggatttaa

DBGET integrated database retrieval system