KEGG   Alligator mississippiensis (American alligator): 102570534Help
Entry
102570534         CDS       T03087                                 

Gene name
TCEA1
Definition
(RefSeq) transcription elongation factor A1
  KO
K03145  transcription elongation factor S-II
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:amj03021]
    102570534 (TCEA1)
Transcription machinery [BR:amj03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     102570534 (TCEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_M TFIIS_C Med26 DBD_Tnp_Mut Glyco_hydro_99 Ku_C
Motif
Other DBs
NCBI-GeneID: 102570534
NCBI-ProteinID: XP_006260001
UniProt: A0A151MNJ3
Position
Un
AA seq 304 aa AA seqDB search
MTAEDEIIRIAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQST
DEEVTSLAKSLIKSWKKLLDGPSTDKDSEEKKKEPASSSQNSPEAREESSSSSNSSSRKE
ETNTPSNSFIHSHPRAPVTTDSVRMKCREMLAAALKTGGDYIAIGADEEELGSQIEEAIF
QELNNTDMKYKNRVRSRIANLKDPKNPNLRKNVLCGNIPPDMFAKMTAEEMASDELKEMR
KNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNR
WKFC
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggaggatgagatcatccgcatcgccaagaagatggacaagatggtgcagaag
aagaacgcggctggagctctggatttattaaaggagcttaagaatattcccatgactctt
gagttgttacagtccacaagaattggaatgtcagtgaatgcaatacgcaagcaaagtaca
gatgaagaagttacatctttagcaaagtctctcatcaaatcatggaagaagttattagat
ggaccttcaactgataaagattctgaagaaaagaaaaaagagcctgcgtcctcatcacag
aatagccctgaagcaagggaagaaagcagttccagtagcaacagcagcagcaggaaggaa
gagactaatactccctcaaattccttcatccattctcatcctcgggctccagtcactaca
gattctgttcgaatgaagtgtagagaaatgctcgctgcagctctcaaaacgggaggtgat
tacattgctattggtgctgatgaggaagaactgggttctcagattgaagaagctatattt
caagaattaaacaacactgacatgaaatacaaaaatagggtacgaagtaggatagcaaat
ctcaaggatccgaagaatcctaatctaagaaaaaatgtcttatgtggaaatatacctcca
gacatgtttgcaaaaatgacagctgaggaaatggcaagtgatgaacttaaagagatgcgt
aaaaatctgaccaaagaagctatccgagaacaccagatggctaagactggaggcacccag
actgacttgttcacatgtggcaagtgtaaaaagaagaattgtacttacacacaggttcaa
acacgtagcgctgatgaaccgatgacaacatttgttgtctgtaatgaatgtggaaacaga
tggaagttctgttag

DBGET integrated database retrieval system