KEGG   Alligator mississippiensis (American alligator): 102570785Help
Entry
102570785         CDS       T03087                                 

Gene name
CDCA5
Definition
(RefSeq) cell division cycle associated 5
  KO
K17390  sororin
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:amj03036]
    102570785 (CDCA5)
Chromosome and associated proteins [BR:amj03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    102570785 (CDCA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sororin
Motif
Other DBs
NCBI-GeneID: 102570785
NCBI-ProteinID: XP_014465561
UniProt: A0A151MLX9
Position
Un
AA seq 208 aa AA seqDB search
MLKRPIVLKKIQPRRQQVAEAAAAPRRSPRISSSSGKENVPAEVSNVAGPSTPAEKPLVE
ISSSTVLSTPTEKPPAHTSPPLDERDTLMAHKVRRSYSRLDATFSPGSGLSDTSTPDQRR
SLFGFALLLAPDVSPVPTAAAPVPVAHDSPPDAPSKGLLDTDLPGIALVKEKRKKKKVVQ
IDVSELDEWAAQMNAQFEEAEKFNLTVE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagcgccccatcgtgctgaaaaagatccagccccggcggcagcaggtggctgaa
gcagctgcggccccacggcgcagtccccggatctcatccagcagtggcaaggagaatgtt
ccggctgaggtcagcaacgttgcgggtccgtctaccccagcagagaagcccttggttgag
atcagcagcagcacggtcctgtctaccccgactgagaagcccccagcccacacctctccc
cccctggacgagcgggacaccctgatggctcacaaggtgcgtcgttcctacagccgcctg
gacgccaccttctcccccggctcggggctctcggacacgtccacgcctgaccagcgccgc
tccctctttggtttcgccctgctgctggcccccgatgtctcccccgttcccacggcagct
gccccggtccccgttgcccacgattcccctcctgacgcccccagcaaggggctattggac
acggacctgcccggcattgccctggtcaaggagaagcgcaagaagaagaaggtggtgcag
atcgatgtatcggagctggacgagtgggcagcacagatgaacgctcagtttgaagaggcc
gagaaattcaacctgactgtggagtga

DBGET integrated database retrieval system