KEGG   Alligator mississippiensis (American alligator): 102571164
Entry
102571164         CDS       T03087                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04080  Neuroactive ligand-receptor interaction
amj04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102571164 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102571164 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 102571164
NCBI-ProteinID: XP_014465437
Position
Un
AA seq 77 aa
MGVRRWLLALLLLWLAVSAGCGGPLAEAPDGKDPEEGNIRNLVYPRGARNGAGHRQNGWR
KYRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgggcgtgcggcgctggctgctggcgctgctgctgctctggctcgccgtcagcgcgggc
tgcggagggcccctggctgaggcaccagatggaaaggatcctgaggaggggaacatccgt
aacctggtgtaccccagaggggcacggaatggagcaggacaccggcagaatggctggcga
aagtaccggcggccaagacctcgtctctcccacaagggccccatgcctttctaa

DBGET integrated database retrieval system