KEGG   Alligator mississippiensis (American alligator): 102572099
Entry
102572099         CDS       T03087                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102572099 (RDH5)
Enzymes [BR:amj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     102572099 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2
Other DBs
NCBI-GeneID: 102572099
NCBI-ProteinID: XP_006267732
UniProt: A0A151NL06
Position
Un
AA seq 326 aa
MWAYAVLCMLLWAIAWLLRDRRRLPGLMGRHVLVTGCDSGFGCRLAQRLDRAGFRVLAAC
LTAQGAEALRAACSPGLRTSLLDLTSSESIASTLAWVQDEVGNQGLFGLVNNAGVANPMG
PTEWLQAEDLRHVVTINALGPAELTLGLLPLLKRARGRVVNISSVLGRLAAAGGGYCPSK
YAVEAFSDSLRRDMAPFGVRVCIVEPGFFRTAATDLGGIEAALGRRWLQLDPETRRSYGD
DFFRQYLQVQRRIMAWLCDPDLTKVTGCLEHALTAQYPRTRYSPGWDAKLLWLPASYLPA
CLVDAVLAAVLPKPAGSIRGAPDTPQ
NT seq 981 nt   +upstreamnt  +downstreamnt
atgtgggcctacgcagtactgtgcatgctgctgtgggcgatcgcctggctgctgcgggac
cggcgccgcctgcccggcctgatgggccggcacgtgctggtcacgggctgcgactcgggc
tttgggtgccggctggcgcagcggctggaccgcgccggcttccgcgtgctggccgcctgc
ctcacagcgcagggggctgaggccctgcgtgctgcctgctcccccggcctgcgcaccagc
ctgctggacctcaccagctccgagagcatcgccagcacgctggcctgggtgcaagacgag
gtgggcaaccaaggcctcttcgggctagtgaacaatgcgggggtggccaaccccatgggc
cccaccgagtggctgcaggccgaggacctgcggcatgtggtgaccatcaatgcactgggg
ccggcggagctgacgctggggctgctgcccctgctgaagcgggcgcggggacgcgtggtc
aacatctccagcgtccttgggcgcctggcagccgcagggggcggctactgcccctccaag
tatgctgttgaggccttctccgacagcctcaggcgtgacatggccccattcggtgtgcgg
gtctgcatcgtggagcccggcttcttccgcacagcggccaccgacctgggcggtatcgag
gcggcactgggccggcgctggctgcagctggaccctgagacgcgacgcagctacggggat
gacttcttccgccagtacctgcaggtgcagcggcgcatcatggcgtggctgtgcgatccc
gacctgaccaaggtgaccggctgcctggaacacgcgctgacagcccagtacccacgcacc
cgatacagccccggctgggatgccaagctgctgtggctgcctgcctcctacctgcccgcc
tgcctggtggacgccgtgctggctgccgtgctgcctaagccagccgggagcatccgcggg
gcacctgacaccccccaataa

DBGET integrated database retrieval system