KEGG   Alligator mississippiensis (American alligator): 102572242Help
Entry
102572242         CDS       T03087                                 

Gene name
ACVR1B
Definition
(RefSeq) activin A receptor type 1B
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04060  Cytokine-cytokine receptor interaction
amj04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102572242 (ACVR1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102572242 (ACVR1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amj01001]
    102572242 (ACVR1B)
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102572242 (ACVR1B)
Protein kinases [BR:amj01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   102572242 (ACVR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Pkinase_fungal Activin_recp APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102572242
NCBI-ProteinID: XP_019353112
UniProt: A0A151MRQ1
Position
Un
AA seq 453 aa AA seqDB search
MVSISNLDGVKYHIRACIPKAELVPAGKPFHCLSSEDVRNTHCCISDFCNKVDLMVPSGH
LKETEPQSSWGPVELVAVIAGPVFLVFVIIIVVVFVFHHHQRVYHNRQRLDMEDPSCEMC
LSKDKTLPDLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVA
VKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFD
YLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGTCAIA
DLGLAVRHDSVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWE
IARRCNAGGIHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKM
MRECWYANGAARLTALRIKKTLSQLSVQEDVKI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggtctccatctccaatctggatggggttaagtatcacattcgcgcctgtatccccaaa
gcagagttggttcctgctggaaagcccttccactgcctgagttccgaagatgtgcgaaac
acgcactgctgcatctcggatttctgcaacaaggtggacttaatggtgcccagcgggcac
ctgaaagaaactgaaccccagtccagctggggccctgtggagctggtggcagtgattgca
ggaccagtcttcctcgtatttgtcatcataattgtggtggtgtttgtcttccaccatcac
cagcgagtctatcacaatcggcagcggttggacatggaagatccctcttgcgaaatgtgt
ctgtccaaggataagaccctgccagatctggtctatgatctttccacctctggctctggc
tcaggtttgcccctctttgtgcagcggactgtagctcgaacgattgtcctgcaggagatc
attggcaaaggccgcttcggggaagtgtggcgaggcaggtggcgtggtggtgatgtggct
gtgaaaatcttttcttcacgggaggagcgctcctggtttagggaggcagaaatataccag
acggtcatgttgcgacatgagaacattctgggatttattgctgcagataacaaagataat
gggacctggacacagctgtggctcgtctccgattaccacgagcatggctccctgttcgat
tacctcaaccgatacactgtgaccattgaggggatgattaagctggccctgtctgcggcc
agcggcttggcccatctgcacatggagatcgtggggacccaaggaaagccagggattgcc
caccgagacttgaaatccaaaaacatcctggtgaagaagaacggcacctgtgccattgct
gacctggggctggctgtccgccatgattcggtcactgatactattgacattgcacccaac
cagagggttggaacaaagcgatacatggcccccgaggtgctggatgaaaccatcaacatg
aagcattttgattctttcaagtgtgccgatatctatgccctgggcttagtctattgggag
attgctcgtaggtgcaacgcaggaggtatccatgaagaatatcagcttccatactacgac
cttgtgccctctgacccgtccattgaggagatgcggaaagttgtatgcgaccagaagctg
cggcccaacattcctaactggtggcagagctatgaggctctgcgagtgatgggcaagatg
atgcgggagtgttggtacgccaatggtgccgctcgactcactgccttgcgcatcaagaaa
acgctgtcgcagctcagtgtccaggaagatgtgaaaatctag

DBGET integrated database retrieval system