KEGG   Alligator mississippiensis (American alligator): 102572433
Entry
102572433         CDS       T03087                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:amj01009]
    102572433 (AKAP5)
Protein phosphatases and associated proteins [BR:amj01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102572433 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 102572433
NCBI-ProteinID: XP_014454327
UniProt: A0A151M228
Position
Un
AA seq 488 aa
MEKAAKDIQTENTAESEMQSAAKLCRPAEEEAEKPSMFCFKKRKKSGKKASDVKGTCEEE
SANLNQTSQCSADHREGKASNPSQSPKGAWAAIKCFVRPRRKLKSSSRKHVPSDSQVQLE
TSTEEAGLQSLPKKEVRSGLKIPCIRFSGGKRKPSQCEMIEESDDSIKGNEAMGILNKAT
SEPEDLATAVKSSPDRSFGQSAAKKDSDSTAEKSDSSAGENELLREPGPDTDQHTACPVQ
SETMNLETVAVIVQEKQCPRSQPETAVHTVTKQDDGNTAFGAEPPEDLPEHVPRVTEVQG
RNAMPEKQPGLDEFGSSISVSEDCKSKETIMGSSQSAFRDEAANVQSCSNEQFKLEESKD
VDGVGIVITVTDADDCNEVEPSYICKLPLIPRHTKPKGNKKSGNFDFSSFSDCQQGSVAG
SGHWREDKNSSHALSPKGLSDQGQRTSEQYELLLIETASSLVKAAIQSSIEQLVNEMALE
HNKQNSFL
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggagaaggcagctaaggatattcaaacggaaaacacagcagagtcagaaatgcagagt
gcagcaaaactgtgccgtccagctgaagaagaggcagaaaaaccctccatgttttgtttt
aagaaaagaaaaaagtcaggcaagaaggcttcagacgtgaagggtacctgcgaagaagag
tctgcaaacttgaatcaaaccagccagtgcagtgcggaccacagagaagggaaagcttca
aatccatctcagtcaccaaaaggagcctgggcagctataaaatgttttgtgagaccaagg
agaaagttaaagtcttcttccaggaaacacgtaccttccgactctcaagtccagctggag
accagtacagaggaggctggcttgcagagtttgcccaagaaagaggttcgttctggtctg
aaaataccatgcataagattttcaggtggcaagagaaaacccagccagtgtgaaatgata
gaggaatcggacgacagtattaagggaaatgaagcaatgggcattttgaataaagctacc
agtgaacccgaggatttggcaactgcagttaaatctagccctgatcgatcctttggccag
tctgctgcaaagaaagacagtgacagtacggctgaaaaaagtgacagttctgctggggag
aacgagcttttgcgagaacccgggccagacaccgatcaacacacagcatgtcctgtccag
tcagaaacaatgaatttagagacagttgctgtaatagtccaggaaaaacagtgtccgagg
agccaaccagaaacagcagtgcatacagtaaccaagcaggatgatggcaacactgcgttt
ggtgctgagccgcctgaggacctaccagagcatgtacctagagtcaccgaggtacaaggt
agaaacgccatgcctgagaagcagcctggactggatgagtttggaagcagcataagcgtt
agtgaggactgtaaatccaaagagacgataatgggttccagtcagtcagcatttagagat
gaggcagcaaatgtacagagctgttcaaacgaacaatttaaattagaagaaagtaaggat
gttgatggggtgggcattgtgattacggttacagatgcagacgattgcaatgaagtggag
cccagctatatctgcaagctgcccttgatcccacgtcatacaaaacccaaagggaataag
aaaagtgggaactttgatttcagtagcttttcagattgccaacagggctcagtggcaggc
agcggccactggagggaggataaaaacagttcccatgctctctcacccaaaggtctcagt
gatcaggggcaaagaacttcagagcagtatgaattgcttctgatagaaaccgcgtcttca
cttgtaaaagcagctattcagtcatccatcgaacagctggttaatgaaatggctttggaa
cataataaacagaacagttttctctga

DBGET integrated database retrieval system