KEGG   Alligator mississippiensis (American alligator): 102572864Help
Entry
102572864         CDS       T03087                                 

Gene name
CACNG3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 3
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04010  MAPK signaling pathway
amj04260  Cardiac muscle contraction
amj04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102572864 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102572864 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    102572864 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:amj04040]
    102572864 (CACNG3)
Ion channels [BR:amj04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102572864 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 102572864
NCBI-ProteinID: XP_006268473
UniProt: A0A151NW35
Position
Un
AA seq 315 aa AA seqDB search
MRMCERGVQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKATGDNETSRKNEEVMTH
SGLWRTCCLEGTFRGMCKKIDHFPEDADYEQDTAEYLLRAVRASSIFPILSVGLLFFGGL
CVAASEFYKSKHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQSDSKKSYSYGWSFY
FGALSFIIAEMVGVIAVHMYIEKHRQIRAKSHSELLKKSAFTRLPTYRYRFRRRSSSRST
EPRSRDLSPVSKGFNTIPSTDISMFTLSRDPSKVTIGTLLNSERDHGFLQVHNSIPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgagcgcggcgtccagatgctcatcaccaccgtgggagccttcgccgcc
ttcagcctcatgaccatcgcggtgggcacggactactggctctactcgcgcggcgtctgc
cggaccaaggccacgggcgacaatgagacgagccgcaagaacgaggaggtgatgacccac
tcgggcttgtggcggacgtgctgcctggaagggactttccgcgggatgtgcaagaagatc
gaccacttccccgaagacgcggactacgagcaggacacggccgagtacctcctccgggct
gtccgagcatccagcatcttccccatcctgagcgtgggcttgctgttcttcgggggcctg
tgcgtggcggccagcgagttctacaagagcaagcacaacgtcatcctcagcgccgggatc
ttcttcgtgtcggcagggctcagtaacatcatcgggatcatcgtctacatctccgccaat
gcgggcgaccccgggcagagcgactccaagaagagctactcgtacggctggtccttctac
ttcggcgccttgtccttcatcatcgcggagatggtgggagtgatcgccgtgcacatgtac
atcgagaagcatcgccagatccgggccaagtcccactcggagctgctgaagaagtcggcc
ttcacgcgcctccccacctaccggtaccgtttccgccggcggtccagctcccgctccacg
gagcctcgctccagggacttgtctcccgtcagcaaaggcttcaacaccatcccctccacc
gacatctccatgttcaccctctcgcgggatccgtccaaggtgaccatagggacactgctc
aactcggagcgggaccacgggtttttacaggtccataactccatccccaaagagttcaag
gagtcgctgcacaacaacccggccaaccgacgaaccacgccggtctga

DBGET integrated database retrieval system