KEGG   Alligator mississippiensis (American alligator): 102574563Help
Entry
102574563         CDS       T03087                                 

Gene name
BLVRB
Definition
(RefSeq) biliverdin reductase B
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00740  Riboflavin metabolism
amj00860  Porphyrin and chlorophyll metabolism
amj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    102574563 (BLVRB)
   00860 Porphyrin and chlorophyll metabolism
    102574563 (BLVRB)
Enzymes [BR:amj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     102574563 (BLVRB)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     102574563 (BLVRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 Epimerase NmrA 3Beta_HSD TrkA_N THF_DHG_CYH_C RmlD_sub_bind Ssl1
Motif
Other DBs
NCBI-GeneID: 102574563
NCBI-ProteinID: XP_019354613
UniProt: A0A151MLY8
Position
Un
AA seq 209 aa AA seqDB search
MATCKNIVIFGATGMTGLATLAQALQAGYQVTVLVRDPARLPPDLHPAHVVVGDVLDPSA
VDRAVQGQDAVIIILGTRNDLSPTTMMSEGTKNIVTAMKAHGIRKVVACLSAFLMWDPAK
VPARLQPVTDDHIRMHRILQDSGLDCVSVMPPHIAGDQPLTGDYTVTVNAASGSRVISKH
DLGHFFLQCLSTAQYDGKNVYLSRHYPKE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggccacctgcaagaacatcgtcatcttcggggccacgggcatgacggggctggccacg
ctggcgcaagccctgcaggccggctaccaggtgacggtgctggtgcgggacccagcgcgg
ctgcccccggacctgcacccagcacacgtggtggtgggcgacgtgctggaccccagcgcc
gtggaccgggctgtgcaggggcaggacgccgtcatcatcatcctgggcacccgcaatgac
ctcagccccaccaccatgatgtccgagggcaccaagaacatcgtgactgccatgaaggcc
cacgggatccgcaaggtggtcgcgtgcctgtcggccttcctgatgtgggacccggccaag
gtgccggccaggctgcagcccgtgaccgacgaccacatccgcatgcaccgcatcctgcag
gactcgggcctggactgcgtctccgtcatgccgccccacatcgccggtgaccagccgctg
accggggactacacggtgaccgtgaacgcagcgagcggctcccgcgtcatctccaagcac
gacttgggccacttcttcctgcagtgcctgagcacggcccagtacgacggcaagaacgtc
tacctctcccgccactaccccaaggagtga

DBGET integrated database retrieval system