KEGG   Alligator mississippiensis (American alligator): 102575265
Entry
102575265         CDS       T03087                                 

Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00230  Purine metabolism
amj00240  Pyrimidine metabolism
amj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102575265
   00240 Pyrimidine metabolism
    102575265
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102575265
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28 AAA_17 CoaE
Other DBs
NCBI-GeneID: 102575265
NCBI-ProteinID: XP_006263586
UniProt: A0A151M771
Position
Un
AA seq 267 aa
MRPSAKRPCLGPSEPDSLDSSFQKRLTKVSIEGNIASGKSTFVRLLEKYSEEWEVIPEPI
AKWCNVQSTDNEYKELTSSQKNGGNLLGMLYDKPTRWAYTFQTFACLSRVKAQLKAASAK
LQEAEHPVQFYERSVFSDRYVFASNLFESGCINETEWAIYQDLHTWFLTTFEPDMQLDGI
IYLRATPEKCMERLQIRGREEEQGIEMEYLESLHHKHETWLHERTIKVDFDNLREIPILV
LDVNEDFKNDKIKQEDLIDKVKAFLKS
NT seq 804 nt   +upstreamnt  +downstreamnt
atgcgcccctcggccaagcgcccgtgcctcggcccctccgagcccgactcgctcgacagc
agcttccagaagcggctcacgaaggtgtccatcgagggcaacatcgcctcggggaaatcc
accttcgtccgcttgctggagaagtatagcgaggagtgggaagtgatccccgagcccatc
gccaagtggtgcaatgtccagagcactgacaacgagtacaaggagcttacctcgtctcag
aagaacggagggaacctacttggcatgctgtacgacaagccaacaagatgggcttacacc
tttcagacgtttgcctgtttgagcagagtcaaggcacagctgaaggctgcctcggccaaa
ctgcaagaagccgagcacccggtgcagttttacgagagatcggtgttcagtgaccggtat
gtgtttgcttccaatctgtttgagtctggatgcatcaacgaaacagaatgggccatttat
caggacttgcatacatggtttctgactacctttgaaccagatatgcagctggatggcatc
atctacctaagagccacaccagagaagtgcatggaaagactgcaaattcgaggcagagaa
gaggaacaaggaatcgagatggagtatttggaaagcctccaccataaacacgaaacctgg
cttcatgagaggactataaaggtggattttgacaacctcagagagatacccattctggtc
ttagatgttaacgaagactttaaaaacgataagattaaacaagaggacttgatcgataag
gtcaaggctttcctgaagtcctaa

DBGET integrated database retrieval system