KEGG   Alligator mississippiensis (American alligator): 102575324Help
Entry
102575324         CDS       T03087                                 

Gene name
GALC
Definition
(RefSeq) galactosylceramidase
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00600  Sphingolipid metabolism
amj01100  Metabolic pathways
amj04142  Lysosome
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102575324 (GALC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102575324 (GALC)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     102575324 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 102575324
NCBI-ProteinID: XP_014451885
Position
Un
AA seq 698 aa AA seqDB search
MAAGAAGGTGMAGIGIGALLWGWVLLGCVWRPGLLGADAGHGHGRGRGRSSARAAATYPL
DDSHGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFMPNFGASLHMLKVEIGGD
GQSTDGTEPSHMHYENDENYFRGYEWWLMKEAKKRNPNIKLIGLPWTFPGWIGRGENWPY
DYPDVTVYYVVSWISGAKQYHDLDIDYIGIWNERSFNSKYIKLLRYTLDKHDLQHVRIIA
SDRLWEPISIAMLFDSELHRVVDIIGAHYPGTKTVGAALLTKKKLWSSEDYSTFNDEVGA
GCWARVMNQNYVNGNMSATIAWNLVASYYEKLPFGRNGLMTAQEPWSGHYKVEPPIWITA
HTTQFTQPGWTYLQADGHLKKGGSYVALTDGLGNLTIIIETMTHNHSECIRPRLLPFSVS
SQKATFYLKGTFSKVKALQVWYSKLDFESANSTLFQPLSPIEVFEGTFTLNLDVDEVYTL
TTLKTGQKYMYREPPPSQPFPSNYKDDFNIRNPAFSEAPNFADQTGVFEYFVNTSDPGDH
VYTLRQVVIQRPITWSSDADQTISIIGDSNWVNMIITCDIYIERPHDGGVFIAGRVDNGG
IYVRRTKGIFFWVFADGTYRVTGDLARKVVLMKGLAGVRDRTWHTLTLALKGSSASGWLN
GYPLWENVPAFKPSNGWAAIGTRSFEFAQFDNFHVEAS
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgggcgctgctggcgggacgggcatggccgggatcggcatcggggccttgctg
tggggctgggtgctgctgggctgtgtctggcgcccgggcctgttgggggccgacgccggc
cacggccacggccgtggccgcggccgcagctcagcccgcgccgcagccacctacccgctg
gacgactcgcacgggctgggccgggagttcgacggcatcggggccgtgagcggcggaggg
gccacctctcgacttcttgtgaattacccagagccctatcgttctcagatcttagattat
ctgtttatgccgaattttggtgcctctctgcatatgctcaaggttgagattggaggtgat
ggtcagtccacggatggtactgaaccatctcacatgcactatgaaaatgatgagaactac
ttccgaggctatgagtggtggctgatgaaagaagctaaaaagaggaaccccaatattaaa
ttgattgggttaccgtggacatttcctggatggatagggaggggtgagaactggccctat
gattatcctgatgtcactgtttactatgttgtttcctggatctcgggtgcaaagcaatat
catgatttggacattgattatattgggatctggaatgaaagatcatttaatagcaaatat
atcaagctcttaagatacaccttggataaacatgatctacagcatgtgaggatcatagcc
agcgatagactgtgggaaccaatttccattgccatgctgtttgactctgagctccataga
gtggtcgatattataggggctcattaccccggtacaaaaaccgtgggtgcagccttgttg
actaagaagaaactgtggtcttcggaagattacagcactttcaatgatgaagtgggtgca
ggctgctgggctcgggtcatgaaccaaaactatgtgaatgggaacatgtctgccaccatt
gcttggaatttggtggccagttattatgaaaaattgccttttggccgaaatggattaatg
actgcccaagaaccctggagtggccattacaaagtagaacctcctatctggatcacagca
catacaacccagttcacccaaccaggctggacctatctgcaggcggatggacacttaaaa
aaaggtggcagctatgtagctcttaccgatggcctaggcaatcttactatcatcattgaa
actatgactcataaccattctgaatgcatcaggccccgactacttcctttcagtgtgtca
tctcagaaagcaactttctacctcaaaggaacctttagcaaagtaaaggcacttcaagta
tggtattcgaagcttgatttcgaatctgcaaattccaccctgttccagccactcagtcct
atagaggtttttgaaggaacatttactttaaatctggacgtagatgaagtctatacttta
accaccctcaagacaggccagaagtatatgtacagggaacctcccccatcacagcctttt
ccttcaaattacaaggatgatttcaatatccgtaacccagcttttagtgaagctccaaat
tttgcggaccagaccggagtatttgagtattttgtcaacacttctgaccctggggatcac
gtctacacacttcgccaagtggtgattcagcgacctatcacttggtcttctgatgcagac
caaaccatcagtatcattggagactccaactgggtaaatatgataataacttgtgacatc
tatatagaacgcccacatgatggtggtgtgttcattgcaggaagagtagataatggtgga
atatatgttagacgtaccaaaggaatattcttctgggtgtttgcagatggtacatacaga
gtcactggtgatcttgctagaaaagtagttctgatgaaggggctcgctggtgtccgagac
agaacttggcacacactcactctggctctcaaggggtcttctgcttcagggtggctgaat
ggctatcctctctgggagaatgtccctgcatttaaaccaagtaacggatgggcagctatt
ggcacacgctcctttgagtttgcgcagtttgataacttccacgttgaagctagttga

DBGET integrated database retrieval system