KEGG   Alligator mississippiensis (American alligator): 102576820Help
Entry
102576820         CDS       T03087                                 

Gene name
KCNK2
Definition
(RefSeq) potassium two pore domain channel subfamily K member 2
  KO
K04913  potassium channel subfamily K member 2
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:amj04040]
    102576820 (KCNK2)
Ion channels [BR:amj04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   102576820 (KCNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 102576820
NCBI-ProteinID: XP_019338723
UniProt: A0A151P3K6
Position
Un
AA seq 422 aa AA seqDB search
MRNPQARHNFYLAAPDLLDPKAATQNSKPRLSFSTKPTVLSSREESDSTINVMKWKTVST
IFLVVVVYLIIGATVFKALEQPHETSQRTTIVIQKQTFVSQHSCVNVSELDELIQQVVAA
INAGIIPIGNTSNQTSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPL
FGFLLAGVGDQLGTIFGKGIAKVEDTFVKWNVSQTKIRIISTIIFILFGCVLFVALPAVI
FKHIEDWDTLDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVL
SMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSIKRK
LSAELAVNHSQDLTPCKRTLSVNHLSSEKDILPALTKTDSIYMNGLTPHCAAEEIAVIEN
IK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacccacaagcaagacataacttctacttggcggcacctgacttgctggatccc
aaagctgccactcagaactccaagcccaggctgtcattttctacaaagcctacagtgctc
tcttcccgggaggaaagtgattcaaccattaatgttatgaaatggaagacagtatcaaca
atttttctggtagtagttgtgtatttaataattggagctactgtctttaaagccctggag
cagcctcatgaaacttctcagagaaccaccattgtgattcagaagcagacgtttgtttcg
cagcattcctgtgtgaatgtatctgagcttgatgaactgattcagcaagtagtggcagcg
ataaacgcaggaatcatacctataggaaacacatctaatcaaaccagtcattgggacttg
ggaagttccttcttctttgctggcactgttattaccaccataggctttggaaacatctca
ccacgtacagaaggtggaaagatattctgtatcatctatgccttactgggaattcctcta
tttggttttctgttggctggagttggagatcaactgggaaccatatttggaaaaggaatt
gccaaagttgaagatacatttgttaaatggaatgtgagtcagacaaagattcgcatcata
tcaacaataatatttatattgtttggctgcgtactgtttgttgctcttcctgcggttata
ttcaagcacatagaagactgggacacactagatgcaatttattttgtagttatcacttta
actaccattggatttggtgactatgttgcaggtggatcagatattgaataccttgatttc
tacaagccagtggtttggttttggatccttgtaggacttgcttactttgcggctgttctc
agcatgattggagactggctaagagtcatatcaaaaaagacaaaggaagaggtaggagag
ttcagagctcatgctgccgaatggacagccaatgtcacagcagagttcaaagaaacccgc
cgacgtttaagtgtagagatttatgacaagtttcaacgggctacctccatcaaaaggaag
ctctctgcagaacttgcagtcaaccacagtcaagatctgactccttgcaagagaaccctg
tcggtcaaccacctaagtagtgagaaggacatcttgccagctctaacaaagactgacagc
atttatatgaatggtttgactcctcactgtgcagcagaagagattgctgttattgaaaac
attaaatag

DBGET integrated database retrieval system