KEGG   Alligator mississippiensis (American alligator): 102577099Help
Entry
102577099         CDS       T03087                                 

Gene name
HEXA
Definition
(RefSeq) hexosaminidase subunit alpha
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00511  Other glycan degradation
amj00513  Various types of N-glycan biosynthesis
amj00520  Amino sugar and nucleotide sugar metabolism
amj00531  Glycosaminoglycan degradation
amj00603  Glycosphingolipid biosynthesis - globo and isoglobo series
amj00604  Glycosphingolipid biosynthesis - ganglio series
amj01100  Metabolic pathways
amj04142  Lysosome
Module
amj_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102577099 (HEXA)
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    102577099 (HEXA)
   00531 Glycosaminoglycan degradation
    102577099 (HEXA)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    102577099 (HEXA)
   00604 Glycosphingolipid biosynthesis - ganglio series
    102577099 (HEXA)
   00511 Other glycan degradation
    102577099 (HEXA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102577099 (HEXA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:amj03110]
    102577099 (HEXA)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     102577099 (HEXA)
Chaperones and folding catalysts [BR:amj03110]
 Intramolecular chaperones
  Others
   102577099 (HEXA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 102577099
NCBI-ProteinID: XP_014459960
Position
Un
AA seq 537 aa AA seqDB search
MTVAGSMACGRLWRVWVWVWVLAGAAGPGGGAVWPQPQHVRVWPGGSSRLVPARFRFGYA
RGSAVGPGCAVLDQAFLRYWRLLFAAQRRPPEHEQLWEVPSNELLVSVTKPGCEDYPNMD
SEESYKLSISEDSFLLTADSVWGALRGLETFSQLVGRAEDGTYYVNKTDIVDFPRFRYRG
LLLDTSRHYLPVGTILETLDVMAYNKLNVFHWHIVDDPSFPYESATFPELSEKGSYNPIT
HVYTPNDVKLVIEHARLRGIRVIPEFDTPGHTLSWGPGAPGLLTPCYIGSKPSGAYGPVN
PILNSTYQFMAVLFKEVSNVFPDFYLHLGGDEVDFTCWRSNPEIRSFMQQMGFGHDYTKL
ESFYIQRLLDIVSSYGKGYVVWQEVFDNGVKVKPDTIIHVWKEGAVPYQHKMAQVTKAGY
RALLSAPWYLNRISYGQDWLAAYKVEPLEFAGSSEQKALVIGGEACMWGEYVDVTNLTPR
LWPRAGAVAERLWSNETVRDPQDAYYRLADFRCKLLRRGIQAEPLYVGYCDHEYSGF
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgcgggtagcatggcgtgcgggcggctgtggcgggtgtgggtgtgggtgtgg
gtgctggcgggggcggcggggcccggcggcggcgccgtgtggccgcaaccgcagcacgtg
cgcgtgtggccgggcggcagctcccgccttgtgcccgctcgcttccgcttcggctacgcg
cgcggctcggcggtggggccgggctgcgccgtgctggaccaggccttcctgcgctactgg
cgcctgctctttgccgcccagcgccgcccgccagagcatgagcaactgtgggaggtgccc
agcaatgagttgcttgtctctgtcaccaagccgggatgcgaagactatcccaacatggat
tccgaggagagctataagctgtccatttcagaggactccttcctgctgactgcggactct
gtgtggggagcactcagaggcctggagaccttcagccagcttgttggacgggctgaagat
ggcacatactatgtcaataagactgacattgtggactttccccgctttcgttatcgaggc
ttgctgctggacacctctcgccactatctgcctgtgggaaccatccttgagacactggat
gtcatggcatacaacaaactaaatgtatttcactggcacatcgtggatgacccctccttc
ccatatgagagtgcaactttcccagagctcagtgaaaaggggtcctacaatcccatcacc
catgtgtacacaccaaatgatgtgaagctggtgattgaacacgctcggctcagggggatc
agagtgatacctgagtttgacacgcctggccacactctatcttgggggccaggtgctcct
ggcttgctaactccctgctacataggctcaaaaccctctggggcctacgggcctgtgaac
cccatcctcaacagcacctaccagttcatggccgtgctctttaaggaggtcagcaacgtg
ttcccagacttctaccttcaccttggtggcgatgaggttgactttacatgctggaggtca
aatcctgaaatccgttccttcatgcagcagatggggtttggccacgactacactaaattg
gaatctttctatattcagaggctgctggatattgtttcctcctatggcaagggctatgtg
gtgtggcaggaggtattcgataatggcgtgaaggtgaagccagacaccatcatccatgtg
tggaaggaaggcgctgtgccataccagcacaagatggctcaggtcaccaaagctggctac
agggctctgctctcagccccctggtacctcaaccgcatctcgtatgggcaggactggctg
gcggcctacaaggtggagcctttggagtttgcaggtagctctgagcagaaggccctggtg
attggtggagaggcctgcatgtggggcgaatatgtggatgtaactaacctgaccccccga
ctctggccgagagctggggctgtagctgagagactgtggagcaatgagacagtgagagat
ccgcaggatgcatattaccggctggcagactttcgctgcaagctactcaggcgtggcatc
caggctgagcccctctacgtaggttactgtgatcatgaatacagcgggttctga

DBGET integrated database retrieval system