KEGG   Alligator mississippiensis (American alligator): 102577293Help
Entry
102577293         CDS       T03087                                 

Gene name
MARS
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00450  Selenocompound metabolism
amj00970  Aminoacyl-tRNA biosynthesis
amj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102577293 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102577293 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amj01007]
    102577293 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:amj03016]
    102577293 (MARS)
Enzymes [BR:amj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     102577293 (MARS)
Amino acid related enzymes [BR:amj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   102577293 (MARS)
Transfer RNA biogenesis [BR:amj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102577293 (MARS)
 Prokaryotic type
   Other AARSs
    102577293 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C_2 Anticodon_1 GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 102577293
NCBI-ProteinID: XP_019346961
Position
Un
AA seq 910 aa AA seqDB search
MPAGGGLPVNPALPEMRLHVGAGPHGAKVLAAAAWGPPGLAWAPPGEHVVPFLTQPCLPA
LQLDSGAVLFSPNAICRYFFLLSGKEQDDVANQWLEWEATELQPAVSAALYLQLVQGKPG
EEALAPVREALAHVDRGLAQRGTTYLTGDAESVADVVVWGALFPLFQDGSCLPDNLGLLG
SWFRSMSQLAPCRAAAAAVLTPEGARELRAHLQRQPVPSPASKRPATNEPEEEESAEHAL
SEEDIAAAADAWAQGTAALPEPWQPQHPVLPVAGRKNVLITSALPYVNNVPHLGNIIGCV
LSADVFARYCRLRNWNTLYVCGTDEYGTATETKAMEEGLTPRQICDKYHAIHARVYSWFG
ISFDYFGRTTTPQQTTIAQDIFGRLLERGFLRSDMVEQLRCERCQRFLADRFVEGVCPFC
AYEEARGDQCDKCGRLINAIELKKPQCKICHDSPVVKSSQHLFLDLPKLEQRLEQWLEQS
WATGDWTANARFITRSWLRDGLRPRCITRDLAWGTPVPLDGFRDKVFYVWFDAPIGYLSI
TANYTDQWERWWKNPEQVELYNFMAKDNVPFHSVVFPCSLLGAEDGYTLVNHLVATEYLN
YEDGKFSKSRGVGVFGDMAKDTGIPADVWRFYLLSLRPEGQDSAFSWADLLLRNNSELLN
NLGNFVNRAGMFVCKFFGGCVPEMELSPDDKRLLARVGLELRHYTQLLDKVRIRDALRCV
LNISRHGNQYIQVNEPWKRIKGNDADRGRASTVTGVAVNMACLLSIMLQPYMPSISASIQ
DQLRAPPACCVLPSAFVCTLPPGHRIGTVTPLFQKLENDQVEALRKRFGGGQAKAAPPKP
PTPGVDLQKVKELSEEVAKQGTHVRELKAAKVEKGQIDTEVAKLLELKRQLVLVEGRPLE
PPAPKGKRKK
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgggggggggctcccggtcaaccccgccctcccggagatgcggctgcacgtg
ggcgcggggccgcacggggccaaagtgctcgcggccgcggcctggggcccccccggcctc
gcctgggccccccccggcgagcacgtggttccgttcctgacgcagccgtgcctgccggcc
cttcagctggacagcggcgccgtcctcttctcacccaacgccatttgccggtatttcttc
ctcctctccgggaaggagcaggatgatgtggccaaccagtggctggagtgggaggccaca
gagctgcagccggctgtttcggccgccctgtatctgcagctggtgcaggggaagccggga
gaggaggcgcttgcgcccgtgcgagaggcgctggctcacgtggaccggggcctggcccag
cgtggcacgacctacctcactggggatgcggagtcagtggccgacgtggtcgtgtggggg
gccctgttcccgctgttccaggatggctcctgcctgccagacaacctggggctgctgggc
agctggttccggagcatgagccagctggcgccgtgccgcgctgcagccgcagccgtgctg
acccctgagggggcgcgggagctccgagcccacctgcagcggcagccggtgcctagccca
gcctccaagcgcccggccaccaatgagcccgaggaggaggagtcagccgagcatgccctt
tcggaagaggacatcgctgcagctgccgacgcctgggcccagggcacagccgcgctgcct
gaaccctggcagccccagcatcccgtgctgcctgtggccggccgcaagaatgtgctcatc
accagcgcgctgccctacgtcaacaatgtgccccacctgggcaacatcattggctgcgtc
ctcagtgccgacgtcttcgccaggtactgccgcttgcggaactggaacacgttgtacgtg
tgcggcacggatgagtacggcacagccacagagaccaaggccatggaggaggggctaacg
cctcggcagatctgcgataagtaccatgctatccacgctcgtgtctacagctggtttggc
atctccttcgactactttggccgcaccaccacaccgcagcagaccacgatcgcccaagac
atctttgggcgcctgctggagcgcgggttcctgcggtcggacatggtggagcagctgcgc
tgcgagcgttgccagcgtttcctggctgaccgctttgtggaaggcgtctgccccttctgt
gcctacgaggaggcccgtggcgaccagtgtgacaagtgtggccgcctcatcaacgccatt
gagctcaagaaacctcagtgcaagatctgccacgattccccagtggtgaagtcctcccag
cacctcttcctggacctgcccaagctggagcagcgcctggagcagtggctggagcagtca
tgggccacaggggactggacagctaatgcccgcttcatcacacgctcctggctcagggat
gggctgcgtccacgctgcatcacacgggacctggcgtggggcacacctgtgcccctggat
ggcttccgtgacaaggtgttctacgtgtggttcgacgcccccattgggtacctgtccatc
acagccaactacacagaccagtgggagcggtggtggaagaaccctgagcaggttgagctg
tacaactttatggccaaggacaacgtccctttccacagcgtcgtcttcccctgttccttg
ctgggtgctgaggatggctacaccctggtgaatcacctcgtcgccacagagtacctcaac
tatgaggatgggaagttctccaagagccggggcgtgggtgtctttggggacatggccaag
gacacggggatcccagctgacgtctggcgcttctacctgctatcgctgcggcctgagggc
caggatagcgctttctcctgggctgatctgctgctgcgcaacaactccgagctgctcaac
aacctgggcaacttcgtcaaccgggctgggatgtttgtgtgcaagttctttgggggctgc
gtgccagagatggagctgagccccgatgacaagcggctgctggcacgggtgggcctggag
ctgcgccactacacacagctgctggacaaggtccggatccgggatgctctgcgctgtgtc
ctcaacatctcccgccatggtaaccagtacatccaggtgaacgagccctggaagcgcatc
aagggcaacgatgctgacaggggccgggcaagcacagtgacgggcgtggcagtgaacatg
gcctgcctgctctccatcatgctgcagccctacatgcccagcatcagtgccagtatccag
gaccagctgcgcgcccctcctgcctgctgtgtgctgccatctgccttcgtctgcaccctg
ccccctgggcaccgcattggcacggtgacccccctgttccagaagctggagaacgaccag
gtggaagccctgcgcaagcgctttgggggtgggcaggctaaagctgccccacccaagccc
cccacacctggtgtggacctccagaaggtgaaggagctgagtgaggaggtggctaagcag
ggcacccatgtgcgggagctgaaagctgccaaggtggagaagggacagatcgacacagag
gtggccaagctgctagagctgaagaggcagttggtattggtggaagggcgtcccctggag
ccccctgcccctaagggcaagagaaagaaataa

DBGET integrated database retrieval system