KEGG   Alligator mississippiensis (American alligator): 106736704Help
Entry
106736704         CDS       T03087                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:amj04131]
    106736704 (DOCK7)
Membrane trafficking [BR:amj04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    106736704 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 106736704
NCBI-ProteinID: XP_006274773
Position
Un
AA seq 2131 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQISGQYGGSPQLLKNLNIGGSVSHHTTVPLTEAVDPVDL
EEYLITHPLAVDSGPLRDLLEFPQDDIEVVYTPRECRTLVSAVPEESEMDPHVRDCVRSY
TEDWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQIFESDEAPDGNSYQDEQDDLKRRS
MSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDHQNDDQRKSNRHKELFALHP
APDEEEPIERLCVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENF
YFDLNSEQMKAMLRPHVPPAAISTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAE
PYMIFKEADAAKNKEKLEKLKSQSDQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDST
EVEVGTGERKGSWSERRNSSIVGRRSLERTTSGDEACNLTSFRPATLTVTNFFKQEGDRL
SDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKLYPDSRVR
PTREILEFPARDVYVPNTTYRNLLYVYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMP
VIFGKSSCPEFSKEAYTAVVYHNRSPDFHEEIKVKLPATLTDHHHLLFTFYHVSCQQKQN
TPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVF
NVEVVAVSSIHTQDPYLDKFFALVHALDEHMFPVRIGDMRIMENNLENELKSSISALNSS
QLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRLHKNLDGNQDQHG
RNSLLASYIYYVFRLPNTYPNSPSPGPGGLGGSMHYATMARSAVRPASLNLNRSRSLSNS
NPDISGTPTSPDDEVRSIIGSKGLDRSNSWVNTGGPKAAPWGSNPSPSAESTQATDRSCN
RMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGSVREAALQQAWFFFELMVKSMV
HHLYFADKLDAPRKNRFPERFMDDIAALVSTIASDIVSRFQKDTEMVERLNTSLAFFLND
LLSIMDRGFVFSLVKAHYKQVSSKLYSLPNPSNLASLRLDFLRIICSHEHYVTLNLPCSL
LTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLVLTELAVILDP
DADGLFGLHKKVINMVHNLLSSHDSDPRYSDPQVKARVAMLYLPLIGVIMETVPQLYDFT
ETHNQRGRPSCVAVDDYESEGGSMISQTVAMAIAGTTIPQLTRPSSFLLTSSTGRQHSTF
SAESSRSLLICLLWVLKNADESVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFER
MNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMT
HWRQNTEKLDKSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVTESKESILGGVLK
VLLHSMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSISTIR
SHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEE
DLELRDTTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQNSPDLRLT
WLQNMAGKHSERSNHAESAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEES
AVSDDVVSPDEEGICSGKYFTEAGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANR
DAKKLSTIHGKLQEAFSKIVHQSTGWERMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITK
LAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRI
TYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRINVIHKEEII
LTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIP
NDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLI
NRKIPQLYKAVLPVACHRDSFSRMSLRKMDI
NT seq 6396 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgccgcgccttcgcgcagaaaatcagcagaactgtggcggctgaagtcagg
aagcagatctcggggcagtatggcgggtctccccagcttctcaaaaatcttaacattggt
ggcagcgtttctcaccatacaactgttcctcttacagaagctgtggatccagtggatttg
gaagaataccttattacacatcctcttgcagtggattctggccctttgagggatttgctt
gaatttcctcaagatgacattgaagttgtatacactccccgggaatgtaggactcttgta
tcagctgtacctgaagagagcgagatggaccctcatgtgagggattgtgtaagaagttac
acagaagattgggcaattgtaaacagaaaatatcacaaactgggaacaggatttaatccc
aacaccttagacaaacagaaagagaggcaaaaagggctccccaaacagatcttcgagtca
gacgaggctccagatggcaacagttaccaggatgaacaagatgaccttaaaaggcgttca
atgtcaatagatgatactccacgaggcagctgggcatgcagtattttcgacctgaaaaac
tccctgcctgatgcccttcttccaaatctacttgaccgaaccccaaatgaagaaattgac
catcagaatgatgatcagaggaagtcaaacagacacaaggagctatttgccctgcatcca
gccccagatgaggaggagcctatagaacgactgtgtgtccctgaagtacccaaagaacac
tttgggcaaagacttcttgtgaagtgtttgtctcttaaatttgaaattgaaattgagccc
atttttgcaagcttggctttgtatgatgttaaagaaaagaaaaagatttcagagaatttc
tactttgatttaaactctgaacaaatgaaagcaatgctgcgtcctcatgtcccacctgct
gccatttctactttggccagatctgctattttttctattacttatccctctcaggatgtc
tttctggttataaagctggaaaaagtattacagcaaggggatataggggagtgtgcagag
ccatatatgatttttaaggaagctgatgctgcaaagaataaggaaaagttggaaaagttg
aaaagtcaatcggatcagttttgccaaagattaggcaaatatcgaatgccttttgcctgg
acagccattcatttaatgaacatagtcagcagtgcgggaagtttggagagagattccacg
gaagtagaagttggcacaggagaacgcaaaggatcttggtcagagaggcgaaattctagt
attgttggaagacgatccttagagagaaccacaagcggagatgaggcttgcaatctgact
agctttaggccagccacacttacagtgacaaacttctttaagcaggagggtgatcgcttg
agtgatgaagatttgtacaagttccttgcagatatgagaaggccgtcttctgttttacgg
aggttgagacccattacagctcagctgaagatagacatatctccagcaccagagaatccc
cactactgcctaactccagagctgctgcaagtcaaactttacccagacagcagagttaga
cctacaagagagatcctggagtttccagccagggatgtgtatgttccaaatactacttac
aggaatcttctgtatgtctatcctcagagccttaactttgccaaccgtcaaggctctgcc
aggaatatcactgtgaaagtccagttcatgtatggagaagatccaagcaacgccatgcca
gtcatttttggtaaatctagctgtcctgaattttccaaggaggcatacacagctgttgtc
tatcacaacagatcgcctgatttccatgaagaaattaaggttaagcttccagctacttta
actgaccatcatcacctcctctttactttctatcatgtcagctgccaacagaaacagaac
actccccttgagactccagttggatatacatggatcccgatgcttcagaatggacgcttg
aagactggtcagttctgtctacccgtttccttggagaaaccgccgcaggcttactctgtg
ctttctccagaggtgccccttcctggaatgaagtgggtagataatcataaaggagttttt
aatgtggaagttgttgctgtatcatctatccatacacaggacccttacctcgacaagttc
tttgcacttgtccatgctctagatgagcacatgttccctgtgcgaattggagacatgagg
attatggaaaacaacttggaaaatgaattaaaaagcagcatttcagctttaaattcatct
cagctggagccagtagtacgctttcttcatctcctgttggataaattgattcttctggta
gtaagaccccctgtcattgcaggccaaatagtcaacctgggacaagcatcttttgaagcg
atggcatcgatcataaacagactccacaaaaacctagatggaaaccaggaccagcatggc
agaaacagtcttctcgcttcttatatttattatgtttttcgtctgccgaacacctacccc
aattcaccttctccaggtcctggtggtttgggaggatcaatgcattatgctaccatggct
cgatcagctgtcagaccagcaagccttaatttgaatcgctcaaggagtcttagtaacagc
aacccagatatatctgggacaccaacctcaccggatgatgaagttaggtcaatcattgga
agtaagggtttagaccgctccaattcctgggtaaacactggtggtcccaaagctgcccca
tggggatccaaccccagtccaagtgcagagtcaacacaggctacggatcgaagttgtaat
cgcatgtcttcgcacacagagacgtcaagtttcttacaaacattaacaggacgattacca
accaaaaagctttttcacgaagaactggccttgcagtgggtcgtttgcagtgggagtgtt
cgggaggccgctctgcagcaggcatggttcttcttcgagcttatggtgaagagcatggtg
catcatttgtattttgctgacaaactggatgcaccaaggaagaatcgctttccggagcgt
ttcatggatgacatagctgctctggtcagcactattgccagtgatatagtttcgcggttt
cagaaggatactgaaatggttgaaaggctcaacaccagtcttgcatttttcctcaatgat
ctgctgtccatcatggacagagggtttgtgtttagccttgttaaggcccactacaaacag
gtatcttcaaagctttattccttaccaaatccaagtaacctggcgtccttgaggctggac
ttcctccgcattatctgcagccatgagcactacgttaccctgaacttaccctgcagctta
cttaccccacctgcttctccatcaccatcagtgtcttcagcaacttctcagagttctgga
ttctctacaaatgtccaagatcagaagattgcaaatatgtttgaactgtctgtgcctttc
cgccagcagcattacttggcaggccttgtgttaacagagttggctgtcattttggatcct
gatgctgatggtttgtttggattgcataagaaggtcatcaatatggtacacaatttactg
tctagtcacgattcggatccacggtactctgacccacaggtaaaggcccgggtggccatg
ctctatctacctctgattggcgtgatcatggaaaccgtgcctcagctatatgattttaca
gagactcacaaccagcgaggaaggccaagctgtgttgctgtggacgattacgaaagcgag
ggtggaagcatgataagtcagacagtggctatggccatcgcagggacaaccatcccccag
cttactcggcccagcagttttctacttacatcctcgactggccggcagcattccaccttc
tcagcggagtcgagccggagcctcttgatctgtctcttgtgggtcctgaagaatgctgat
gagagcgtcctgcagaaatggttcacagacctctctgtgctgcagctcaatcgcttgctg
gatttgctttatctctgtgtttcctgctttgagtacaagggcaagaaagtgtttgaaaga
atgaacagtttgacatttaagaagtcgaaggacatgagagccaaactggaagaagctatt
ctgggaagtataggagccaggcaagaaatggttagaaggagcagagggcagctagaaaga
agtccatctgggagtgcattcggaagccaagagaatttgagatggagaaaggatatgaca
cactggcgtcaaaacacagagaaacttgacaaatcaagggcagagatagaacatgaagca
cttattgatggaaatcttgcaactgaagctaatctgattattttggatactttagagata
gttgtccagaccgtttctgtgactgaatccaaagagagtatccttggtggggtgctgaaa
gtgctgctgcacagcatggcttgtaatcaaagtgcactttatctccaacactgcttcgct
acacaaagagctttggtttcaaagttccccgagctgctgtttgaagaagagacagagcag
tgtgctgacctgtgcctaaggcttctgcgacactgcagtagtagcattagcacaatacgc
tcacatgctagcgcttcactttacctccttatgagacagaattttgagattgggaataac
ttcgctagagtgaaaatgcaggtgaccatgtccctctcatcactggtggggacatcccag
aacttcaatgaggagtttttgagacgttccctgaagactattttaacctatgctgaagag
gatctggaactcagagacacaacattccctgatcaggtccaggatcttgtattcaacctc
catatgatcctctctgacacagttaaaatgaaggaacaccaggaagatccagaaatgctg
attgacctgatgtacagaattgccaagggctatcagaattcccccgacctgcgactgacc
tggttacagaacatggccggaaaacattccgaaaggagcaaccacgctgaatctgcacag
tgtttggtccactcagcagcacttgtggctgaatatttaagcatgcttgaagatcggaaa
tacctgcctgtaggatgtgtcacatttcagaacatatcttctaatgttttggaagaatct
gcagtttctgatgatgttgtatcaccagacgaagaaggtatctgttctggaaagtatttt
acagaagcaggtctggtgggattgctggaacaggcggcagcatctttttccatggctggc
atgtatgaagcagtaaatgaggtttacaaagtcctcattcctattcatgaagctaataga
gatgccaagaaactgtctacaattcatggtaaacttcaagaagcgttcagcaaaattgtt
catcagagtactggctgggagcggatgtttggtacatacttccgggttggcttttacggc
actaaatttggagacttagatgagcaagaatttgtgtacaaggaacctgccataacaaag
ctggcggaaatatcccatagactggaggggttttacggagaacggtttggtgaagatgtt
gtggaagtgattaaagactctaaccctgtagacaaatgtaaactagatcctaacaaggcc
tacatccaaataacctatgtggaaccttatttcgacacatatgagatgaaggacaggata
acctattttgacaaaaactataacctgcggcgtttcatgtactgcacgcccttcaccctg
gatggccgggcacatggggagctgcatgagcagttcaagaggaagacaatcttgactaca
tcacatgctttcccttacattaaaactagaataaatgtcatccacaaagaggagatcatt
ttgactcccattgaagtggccattgaggacatgcagaaaaaaacacaggaactggctttt
gcaactcatcaagatccagcagatccaaagatgctccagatggtgcttcagggttcagtc
ggcacaacggtaaatcagggaccattagaagttgcacaggttttcttgtctgaaataccc
aatgatccaaagctcttcagacaccataacaaactacggctctgtttcaaagacttcaca
aaaaggtgcgaagatgcactgcgcaagaacaagagcctgataggcccagaccaaaaggag
tatcagcgggagcttgagaggaactaccaccgtcttaaagaagctctccagcccttgatt
aacaggaagatcccacagctatacaaggctgtgctgcctgttgcttgccatagagactcc
ttcagcagaatgagccttcgcaaaatggatatctag

DBGET integrated database retrieval system