KEGG   Alligator mississippiensis (American alligator): 106737232Help
Entry
106737232         CDS       T03087                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase 1 soluble subunit alpha 2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00230  Purine metabolism
amj01100  Metabolic pathways
amj04270  Vascular smooth muscle contraction
amj04540  Gap junction
Brite
KEGG Orthology (KO) [BR:amj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106737232 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106737232 (GUCY1A2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106737232 (GUCY1A2)
Enzymes [BR:amj01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     106737232 (GUCY1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB Ntox34 DUF4761
Motif
Other DBs
NCBI-GeneID: 106737232
NCBI-ProteinID: XP_014456157
UniProt: A0A151P7I0
Position
Un
AA seq 555 aa AA seqDB search
MQEKFGEEFFNICFDENERVLRAVGGSLQDFFNGFDALLEHIRTSFGRQATLESPSFLCK
ELPEGNLMLQYFHPHNIVGFAMMGMIKAAAKKIYHLEVEVEQITNDKLCSEGSNPGNCSS
LTFLIKERENANITKTLPLGTSQSPSDLRISISTFCRAFPFHLMFDPNMLVLQLGEGLRK
QLRCDVHKTLTFQDCFDIVSPKISATFERVLLRLSTPFVIRTKLEASGSENKDKVMEIKG
QMIHVPESNSILFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKR
MDKLKATLECTHQALEEEKKRTVDLLISIFPENVAQQLWQGQQVQARKFDDVTMLFSDIV
GFTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHKKSLSHAKA
IALMALKMMELSEEVLTPDGSPIKMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFE
SGSHPRRINVSPTTYQLLKKEENFIFIPRSRDELPDNFPKEIPGICYFLEVRSGQKQPKP
SITSARALTKQLVLQ
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaatttggggaggaattcttcaatatctgctttgatgaaaatgaaagagtt
cttcgagctgtaggtggcagcttgcaggacttcttcaatggttttgatgcattgctggag
catattagaacttcatttggaagacaggccactctggaatccccttctttcctatgcaaa
gagcttcctgaaggcaatcttatgctccagtactttcacccacataatattgttggattt
gcaatgatggggatgataaaggcggcagcaaaaaagatttaccatttggaagtggaagtg
gaacaaatcactaatgataaattgtgctcagaggggtcaaaccctggcaactgcagcagt
cttacttttcttatcaaggaacgtgaaaatgcaaatatcacaaaaacacttccactagga
acgtcccagtccccctcagacctgaggataagcatcagcaccttctgcagagcttttccc
ttccatctgatgtttgatcccaacatgctggtgctccagcttggggaaggtcttaggaag
cagctcagatgcgatgttcacaaaacattgacattccaggactgctttgacatagtttct
ccgaagatcagtgccacatttgaacgagtcctcctgagattatcaaccccatttgtgatt
cggaccaaacttgaggcttctggctctgaaaataaagataaggtgatggaaatcaaaggc
caaatgatccacgtgcctgaatcaaattccattttgtttttgggttccccttgtgtggac
aagctagatgaactgatgggccgaggcctccatctttcagacatacctatccacgatgct
acccgtgatgttatactggttggggagcaggcaaaggcccaagatggcttgaaaaaacga
atggataaattgaaggcaacattagaatgtacacaccaagctctggaagaggaaaaaaag
aggacagtagatcttctgatttcaattttcccagaaaatgtggctcaacaattatggcag
gggcagcaagttcaggccaggaagtttgatgatgtcaccatgctcttttcagacattgtt
ggctttacagctatctgtgcccagtgcacacccatgcaggtgatcagcatgttgaatgag
ctctatactcgattcgaccatcagtgtggattcctcgatatctacaaggtggaaacaata
ggtgatgcgtactgtgtcgcagcagggctccataaaaagagccttagccatgctaaagcc
attgccctgatggctctgaagatgatggaactttcagaagaggttcttactccagatggg
agccctattaagatgagaataggcattcactcaggatcagttctggctggagttgttggg
gttagaatgccacgttattgtctctttggaaacaacgtcacgcttgcgagcaagtttgag
tcaggaagtcatccacgacgcatcaatgtcagtccaaccacataccagcttctgaaaaaa
gaagaaaattttatctttattcctcggtcccgtgatgagcttccagataactttccaaag
gaaattcctgggatctgttacttcctggaggtcagaagtggtcagaagcagccaaagcct
tccatcacatctgccagagccctgactaaacaattagtactgcagtaa

DBGET integrated database retrieval system