KEGG   Alligator mississippiensis (American alligator): 109286058Help
Entry
109286058         CDS       T03087                                 

Gene name
ZDHHC19
Definition
(RefSeq) zinc finger DHHC-type containing 19
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
KEGG Orthology (KO) [BR:amj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109286058 (ZDHHC19)
Enzymes [BR:amj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     109286058 (ZDHHC19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 109286058
NCBI-ProteinID: XP_019354579
UniProt: A0A151MM29
Position
Un
AA seq 236 aa AA seqDB search
MSRGGEEPRWVLPSLCASFHVSSLVCLSALFFSFPCGWLAVHVSLAFPVVAGILFLPALA
NLLLASFMDPGILPRGAKGRARLVIQVLRDEDRRFGPRWCHKCHCYCPPRSFHCPSCNVC
VEGFDHHCYWLNNCVGRGNTRCFSLFVAFLCGYNALALASCIAYLVLSSGQVLSTEKACA
IVVTVPAAFYLLPLLALMSSRAKLHAWAKRTHRLKVYSRGKKTLLGRAWARSWAPA
NT seq 707 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtgggggcgaggagccgcgctgggtgctgcccagcctgtgcgcctccttccac
gtcagctccctcgtgtgtctcagcgccctcttcttctccttcccgtgcggctggctggct
gtccacgtctccttggccttccccgtcgtggctggcatcctcttcctccctgccctggcc
aacctgttgctggccagcttcatggaccccgggatcctgccccgaggggccaagggccgg
gccaggctggtcatccaggtgctccgtgacgaggacagacgcttcggtccgcgctggtgc
cacaagtgccactgctactgcccgccgcggagcttccactgcccctcctgcaacgtctgc
gtggagggcttcgaccaccactgctactggctgaacaactgcgtgggccgcggcaacacc
cgctgcttctccctcttcgtggcctttctgtgtggctacaatgcgctggcgctggcctcc
tgcatcgcctacctggtgctcagctctggacaggtcctcagcaccgagaaagcctgcgcc
atcgtggtgaccgtccccgccgccttctacctgctgcccctcctagccctgatgagctcc
cgcgccaagctgcacgcgtgggccaagcgcacccacaggctcaaggtctacagccgaggc
aagaagaccctgttgggcagggcttgggccaggagctgggcacccgc

DBGET integrated database retrieval system