KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_00530Help
Entry
AMBLS11_00530     CDS       T02260                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00230  Purine metabolism
amk01100  Metabolic pathways
Module
amk_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AMBLS11_00530
Enzymes [BR:amk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AMBLS11_00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase MMR_HSR1 ABC_tran AAA_33 AAA_18 AAA_22 AAA_16 DUF815 AAA_29 AAA AAA_23
Motif
Other DBs
NCBI-ProteinID: AFT76700
UniProt: K0CW69
Position
131541..132182
Genome map
AA seq 213 aa AA seqDB search
MASLLGNLFILAAPSGAGKSSLIKALMEKYEGNTDTPMQVSVSHTTRQPRPGEVDGVHYH
FVSREQFEALIEQGVFFEYAEVFGNYYGTSRVTIEQTLHRGIDVFLDIDWQGARQVKKLM
PDTCGIFILPPSLDVLEQRLNNRGQDSDEVIAGRMAQAVAEMSHFNEFDSVIVNDDFATA
LNDLEAIVIAQRLRTVKQQMRHQVLLDELLGSA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactactcggcaacttatttattcttgctgctccttcaggggcaggaaaatca
agccttataaaggcgctaatggaaaagtatgaaggcaatacagacacgcctatgcaggta
tctgtatctcatacaacacgtcaacctcgtcctggtgaagtcgacggtgtgcactatcat
tttgttagccgagagcagtttgaagcactgattgaacagggtgtgttttttgaatacgca
gaggtatttggaaactattacggcacatcccgtgtgacgattgaacaaactttgcaccgt
ggtattgacgtatttttagatattgattggcagggcgcgcgccaagtcaaaaagcttatg
ccagatacgtgtggtatttttattctgcctccatcacttgatgtgcttgagcagcgtttg
aataatcgcggtcaggacagtgatgaggtgatagcagggcgtatggcacaagccgtggct
gaaatgtctcatttcaatgaatttgacagtgtgattgtgaacgatgactttgcgacagcg
ctgaacgatctagaagctatcgttattgcacagcgtctgcgcacggtaaaacaacaaatg
cgccaccaagtgctattggacgaactgctcggtagcgcgtaa

DBGET integrated database retrieval system