KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_01745Help
Entry
AMBLS11_01745     CDS       T02260                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk03010  Ribosome
Brite
KEGG Orthology (KO) [BR:amk00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AMBLS11_01745 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:amk03011]
    AMBLS11_01745 (rplV)
Ribosome [BR:amk03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AMBLS11_01745 (rplV)
  Bacteria
    AMBLS11_01745 (rplV)
  Archaea
    AMBLS11_01745 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFT76941
UniProt: K0CYZ6
Position
411321..411653
Genome map
AA seq 110 aa AA seqDB search
MEALAKHRFARTSAQKARLVADQIRGMHVEKALELLAYSPKKSAALVKKVLESAIANAEH
NEGADIDELRVSKVFVDEGPTMKRIKPRAKGRADRIFKRSSHITVVVADN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagcattagctaaacaccgttttgcccgcacgtcggctcaaaaggcacgcttggtt
gcggatcaaattcgcggaatgcacgttgagaaagctcttgagcttcttgcgtacagcccg
aagaaaagcgcagcgctagtaaagaaagtattggaatctgcgattgctaacgcagagcac
aacgaaggcgcagacatcgacgaattacgcgtgtctaaagttttcgttgacgaaggtcca
actatgaaacgtatcaagccacgtgctaaaggccgtgctgatcgtatcttcaagcgcagc
agtcacatcactgtggttgtagcggataactag

DBGET integrated database retrieval system