KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_02650Help
Entry
AMBLS11_02650     CDS       T02260                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
amk  Alteromonas macleodii Black Sea 11
Brite
Enzymes [BR:amk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AMBLS11_02650 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_23 Methyltransf_4 Methyltransf_11 DREV Methyltransf_32 MTS DUF938 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: AFT77122
UniProt: K0D033
Position
complement(612535..613170)
Genome map
AA seq 211 aa AA seqDB search
MRASRKGDALAELLYNEGIRSQAVLNAIAGTPRESFLPDALKHKAYQNTALPIGQGQTIS
QPYIVAKMTELLLDSPNKPEKVLEIGTGSGYQTAILAQLFAKVFSVERIKSLQFQAKRRM
NQLDLHNIAMKHGDGWKGWASKGPYDAIIVTAAAASLPQDLCDQLKEGGRLIIPVGNEQQ
SLLCIDRIEGELTTSTIESVRFVPLVAGELM
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttctagaaaaggagacgcgttagcagaactgctttacaacgagggaatacgt
tcgcaagcagtattaaacgccattgctggtacgccgcgggaaagctttttacccgatgcg
ctgaaacacaaagcctatcaaaatacggcgttaccgataggtcaaggccagacaatttcg
caaccatatattgttgcgaaaatgactgagttgctgctggatagccctaataaacctgag
aaagttttagaaataggcacgggctctggttatcaaactgctattctggcgcaactattt
gccaaagtattcagtgttgaacgtattaagtcattgcagttccaagcgaagcgtcgaatg
aatcaactcgaccttcacaacattgcaatgaaacacggtgatggttggaagggctgggcg
tccaaaggtccttatgatgctattatcgttactgccgctgctgcgagcctgcctcaggac
ttgtgcgatcagcttaaagaaggcgggcgactcattatacccgtaggcaacgaacaacaa
tcgttgctatgtattgataggattgaaggtgaactaacgacatcgaccattgaatcggtc
cgatttgttccccttgtagcaggagagctaatgtga

DBGET integrated database retrieval system