KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_05190Help
Entry
AMBLS11_05190     CDS       T02260                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00620  Pyruvate metabolism
amk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMBLS11_05190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amk02000]
    AMBLS11_05190
Enzymes [BR:amk01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     AMBLS11_05190
Transporters [BR:amk02000]
 Other transporters
  Primary active transporters [TC:3]
   AMBLS11_05190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 RnfC_N PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AFT77626
UniProt: K0D147
Position
1212767..1214587
Genome map
AA seq 606 aa AA seqDB search
MSKPLALTELVLRDAHQSLLATRMRIEDMLPIAEKLDKAGFWSVESWGGATFDACIRYLG
EDPWERIRKLKAAMPNTRQQMLLRGQNLLGYRHYADDVVTRFVERAHESGVDVFRIFDAM
NDIRNLKTAIKATIDSGAHAQGTISYTVSPVHNLKLWLEMAKQLEDLGVHSICVKDMAGL
LKPYECEALITRLKETVNVPIAMQCHATTGLSTATYQKAIDAGIDMLDTAISSMSMTYGH
SATETMVSIVEGTERDTGISLPELEDIASYFREVRKKYSKFEGSLKGVDARILLAQVPGG
MLTNMESQLKEQGAEDKFEEVLKEIPRVREDLGFIPLVTPTSQIVGTQSVLNVLTGERYK
SITKETAGVLKGEYGATAAPVNKELQARVLDGAEPVTCRPADNIAPELETLSKELDELAE
KKQLSLSDDKIDDVLTYALFPQIGLKFIENRGNPDAFEPAPSDQESQSSNAPKPAEAKSN
SQGDTTSETYDVNVDGKVYRVEVAPSGTLTSVTPASGSQTQAQPQTNSAAPSASTASQSI
DAPLAGNVFKILVRNGDSVSEGDVVMILEAMKMETEIRCAYTGTVTDITVGEGDAVTSGQ
PLILLG
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcctctggccctaaccgagctggtcctgcgtgatgcccatcaatcactcctt
gctacgcgtatgcgtattgaggatatgcttcctattgcggaaaaattagataaagctggc
ttttggtcggttgaatcatggggtggtgctacatttgatgcctgtattcgttatttgggg
gaagacccatgggagcgcattcgaaaattaaaagcagccatgcctaacacgagacagcaa
atgttgctgcgcggtcaaaatttattaggctaccgacactatgctgatgatgttgttacc
cgttttgtagagcgagcccacgagagtggggtcgatgtatttagaatttttgatgctatg
aacgacatcagaaatttgaaaaccgcaataaaagcgaccatcgacagtggcgcccatgcc
caagggacaatctcttacacggtaagtccagtgcacaaccttaagctttggcttgaaatg
gcgaagcagttggaggacttgggagttcattctatctgcgtaaaagatatggcaggtctt
ttaaaaccgtatgaatgcgaagcactgatcacgaggctgaaagaaaccgtcaatgttccc
attgccatgcagtgccacgccacgacaggattaagcacagcaacatatcaaaaagctatt
gatgccggtatcgatatgctggatacggctatctcctctatgagcatgacttacggccat
agtgcgactgaaaccatggtttctattgtggaaggtacagagcgcgatacgggcatttca
ctgcccgagcttgaagacattgctagctacttcagagaagtaagaaaaaaatacagtaag
ttcgaaggcagcctcaaaggggtagatgcacgtattcttttggctcaagtgccaggtggg
atgctaaccaatatggaaagccagcttaaagagcagggcgctgaagataaattcgaagaa
gtattaaaagaaattccacgggtacgggaagatcttggatttattcccctagttacgcca
acctcacaaattgtaggcacgcagtcggtactcaatgtacttaccggcgagcgttataaa
agcattactaaagaaaccgcaggcgttcttaagggtgaatatggcgctaccgctgcacca
gtaaataaagagttgcaggcgcgtgtgcttgatggtgcagagcccgtgacctgccgtcct
gctgacaatattgccccagagcttgaaacgcttagtaaagaacttgatgaactggctgag
aaaaagcaactctcgctgtcagacgataaaattgacgatgttttgacttatgccttattc
ccacagataggccttaaatttatcgaaaaccgcggcaaccctgacgcatttgaacctgca
cctagcgatcaagaatcacaaagttcgaatgcacctaagcctgctgaagccaagtcaaac
tcacagggggatacaacgagtgaaacttacgatgtaaatgtagatggaaaagtgtatcgc
gttgaagtggcaccctcaggtacgctgacgagcgttacacctgctagtggctctcagaca
caagcacagcctcaaaccaatagcgctgcgccatcagcctctaccgcttctcagtctatt
gatgcaccgcttgcaggtaacgtgttcaaaatcttggtgagaaacggcgacagcgtgtca
gaaggcgatgtggtgatgatccttgaagccatgaaaatggagacagagatccgttgtgca
tatacaggtacggtcaccgatattaccgtaggtgagggcgatgccgtaaccagtggccaa
ccgttaatcttattggggtag

DBGET integrated database retrieval system