KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_06515Help
Entry
AMBLS11_06515     CDS       T02260                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00260  Glycine, serine and threonine metabolism
amk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amk01100  Metabolic pathways
amk01110  Biosynthesis of secondary metabolites
amk01130  Biosynthesis of antibiotics
amk01230  Biosynthesis of amino acids
Module
amk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMBLS11_06515
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMBLS11_06515
Enzymes [BR:amk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMBLS11_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth RsmJ NanE GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AFT77889
UniProt: K0CWI0
Position
complement(1530921..1531730)
Genome map
AA seq 269 aa AA seqDB search
MDRYAQMFAGLDEKNQGAFVPFVMVGDPDLAQSEAIICQLVESGADALELGIPYSDPIAD
GPTIQASAIRALSNKVTVADCLGVISRVRAKYPDVPIGLLLYSNLVMAQGIENFYNKAQE
AGVDSILIADVPIREAAPFQKAAEATGISQILIAPPNATDETMEKIGEYSKGYTYLLGRA
GVTGAETAANVPASELIERLNKHKAAPALLGFGISTPEQVKSAIDAGAAGAISGSATVNI
IAANLSDSHKMLSELGSFVESMKAATAKG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggatagatatgcacagatgtttgccggccttgatgaaaagaaccaaggcgctttcgta
cctttcgtaatggtaggtgaccccgatttagcgcaatctgaagccattatttgccagcta
gtagaaagcggtgctgacgcacttgagttaggtataccttactctgaccccatcgcagac
ggccccacaatccaagcttctgccattcgcgcgttaagtaataaggtgacggtagcagat
tgcttgggcgttatttcacgtgttcgcgcaaaatatccagacgtgcctatcggcttgcta
ctgtacagcaacttagttatggcccaaggtatagagaacttttacaacaaagcgcaagag
gcaggcgttgactcaattttgattgcagacgtgccaattcgcgaagcggcaccttttcaa
aaagctgcagaagcaacaggcatttctcaaattttgattgcaccgccgaatgctactgac
gaaaccatggaaaaaatcggggaatactcaaaaggctatacatacctgctaggccgtgcg
ggcgttacaggtgcagaaactgccgcaaacgtgcctgcttcagagcttattgagcgcttg
aataaacataaagcagcaccagcattgttaggttttggtatttctacacctgaacaggtt
aaatctgctattgacgcaggtgccgctggcgcaatttcaggctcggcgacggtgaacatc
atcgctgccaatttatcggacagtcacaaaatgctaagcgagctcggcagctttgttgaa
agcatgaaagcagctacggcgaaaggataa

DBGET integrated database retrieval system