KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_06525Help
Entry
AMBLS11_06525     CDS       T02260                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amk01100  Metabolic pathways
amk01110  Biosynthesis of secondary metabolites
amk01130  Biosynthesis of antibiotics
amk01230  Biosynthesis of amino acids
Module
amk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMBLS11_06525
Enzymes [BR:amk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AMBLS11_06525
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     AMBLS11_06525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C FMN_dh TMP-TENI
Motif
Other DBs
NCBI-ProteinID: AFT77891
UniProt: K0D1V1
Position
complement(1532932..1534341)
Genome map
AA seq 469 aa AA seqDB search
MANVLEKIVADKREEVAARKEALPLESFKANLVPSEKGLFAALSEPNAGFIFECKKASPS
KGLIREHFDLDEILAAYTPYAAGISVLTDEKYFQGKFEYLAYVTERVAHPVLNKDFFVDT
YQVYLARHYNADAVLLMLSVLNDDEYRELASVANALSLDILTEVSNEEEMERAIALEANI
IGINNRNLRDLSTDLATTERLVPMLEKATHDYVVISESGIYTHQDVLRLAPVSQGFLVGS
ALMAESDLPRAVKTLVNGAVKVCGLTNPEQAQMAFDKGASFGGLIFAEKSPRCVSEAQAL
TITQSVDGAFVGVFVNRDIDEVTSLAASLNLFAVQLHGSEDDTYISALAAKLPEGCEIWK
VEGVKATSSDALPDAVDRHLNNNLVSRVLLDCQVGDAKGGTGEAFNWQLLNDIEAKHKLV
LAGGINAQNVAEAIATGCGAIDVNSGVETAPGVKSEEKLDALFAICRRY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgtgcttgagaaaattgttgcagacaaacgagaagaagtggccgcacgcaaa
gaagcactgccgctagaaagcttcaaggcgaatctagttccttctgaaaagggtttattt
gcggcacttagtgagccaaatgcaggctttatcttcgaatgcaaaaaagcatcgccttca
aaaggccttattcgagagcatttcgatttagacgagatcttagctgcttacacgccttac
gctgccggtatttctgtgctgacagacgagaagtacttccaaggtaaatttgagtactta
gcttatgttactgagcgtgttgctcaccctgtgcttaacaaagatttcttcgttgatacc
tatcaagtgtatctagcccgtcactataatgccgacgcagtgctattaatgcttagtgtg
ctaaatgatgacgaatatcgcgagttggcaagcgttgccaatgctctgtcattagacatt
cttaccgaagtaagtaatgaagaagaaatggagcgcgctattgcccttgaagccaacatc
attggtatcaataatcgcaacttacgcgacctttctaccgatttagcgaccaccgaacgc
cttgtgcccatgcttgaaaaagccacgcatgactacgtggttatttcagagtcgggcatc
tacacacaccaagacgtgcttcgtttagcgcctgtatcccaaggctttttggtgggcagt
gcgttaatggcagagtctgacctaccgcgcgcagtgaaaacgttagtgaatggtgcagtt
aaagtgtgtgggcttaccaaccctgaacaagcgcaaatggcgtttgataaaggcgctagc
tttggcgggcttatcttcgctgaaaaatcgccacgctgtgtgagcgaagcacaggctttg
actataacgcagagcgttgacggtgcttttgttggtgtgttcgttaatcgcgacattgat
gaagtgacatcactcgccgcctcgctcaacctttttgccgtgcagcttcacggcagcgaa
gatgacacctacatttcagcgcttgctgccaagcttccagaaggttgtgaaatttggaaa
gtcgaaggtgttaaagcaacctcttctgacgcactaccagacgcagtggacagacactta
aataataaccttgtaagccgcgttcttctggattgccaagtgggtgatgccaaaggcggt
acaggcgaagcgttcaattggcagctattaaacgatatcgaagcgaagcataagttagtg
cttgctggcggtattaacgcccagaatgttgcagaagctattgcaaccggctgtggtgct
attgatgtgaattcaggcgtagaaaccgccccaggcgtgaaaagcgaagaaaaactcgac
gcgctttttgctatttgccgccgttactaa

DBGET integrated database retrieval system