KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_07985Help
Entry
AMBLS11_07985     CDS       T02260                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00071  Fatty acid degradation
amk00072  Synthesis and degradation of ketone bodies
amk00280  Valine, leucine and isoleucine degradation
amk00310  Lysine degradation
amk00362  Benzoate degradation
amk00380  Tryptophan metabolism
amk00620  Pyruvate metabolism
amk00630  Glyoxylate and dicarboxylate metabolism
amk00640  Propanoate metabolism
amk00650  Butanoate metabolism
amk00900  Terpenoid backbone biosynthesis
amk01100  Metabolic pathways
amk01110  Biosynthesis of secondary metabolites
amk01120  Microbial metabolism in diverse environments
amk01130  Biosynthesis of antibiotics
amk01200  Carbon metabolism
amk01212  Fatty acid metabolism
amk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMBLS11_07985
   00630 Glyoxylate and dicarboxylate metabolism
    AMBLS11_07985
   00640 Propanoate metabolism
    AMBLS11_07985
   00650 Butanoate metabolism
    AMBLS11_07985
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMBLS11_07985
   00072 Synthesis and degradation of ketone bodies
    AMBLS11_07985
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMBLS11_07985
   00310 Lysine degradation
    AMBLS11_07985
   00380 Tryptophan metabolism
    AMBLS11_07985
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMBLS11_07985
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMBLS11_07985
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AMBLS11_07985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amk04147]
    AMBLS11_07985
Enzymes [BR:amk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMBLS11_07985
Exosome [BR:amk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMBLS11_07985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ChlamPMP_M CHGN
Motif
Other DBs
NCBI-ProteinID: AFT78178
UniProt: K0D018
Position
1891197..1892378
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPIGRAYKGALNNLPAPSLGGHAIQNAVARAGIDPASVDDVVMGAALTQ
GSGGMNIGRLAGLAGGLPVTVAGMTLDRQCSSGMYAIATAANSIRTGDTNIMVAGGLDSI
SLVQNKNMNMFRAVDPALVAKHKDIYMPMLQTAEVVGKRYNISRDVQDEYGYQSQMRTAA
AQEAGKFDDEIVPITAVQTVFNKETGETSEREVTLSKDEGNRPETTLEGLKALNPVIEGG
CITAGNASQLSDGASATVIMDEQTAAKGNAQPLGIYRGIAVAGCEPDEMGIGPVFAIPKL
LKQHGLTMDDIGLWELNEAFAVQVLYCRDKLGIPDELLNVNGGAISIGHPYGMSGARMVG
HALIEGKRRGAKYVVCTMCIGGGMGAAGLFEVI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgcagttattgtaagtacagcacgtacgccaatcgggcgtgcctacaaaggt
gcactgaataacttaccagccccttcattaggcggacatgccattcaaaacgcggtagca
cgcgcagggatcgaccctgccagtgttgatgacgtggtaatgggcgcagcgctaacccaa
ggcagtggcggcatgaatattggccgcttggctggcctagcgggtggtttaccggtcacc
gtagcgggtatgacactcgaccgccaatgcagttctggcatgtatgccattgctaccgca
gcgaattcaattcgtacaggcgataccaacattatggttgcgggaggcttagattctatc
tctttagtgcaaaacaagaatatgaatatgtttcgtgcagtagaccctgcactggttgct
aagcacaaagatatttatatgccaatgcttcaaacggcagaagtggtaggcaagcgttat
aacattagccgtgacgtacaagatgaatacggttaccagagccaaatgcgcaccgcagct
gcgcaagaagcgggtaagtttgatgatgaaatcgttcccattaccgcagttcaaaccgtt
tttaataaagaaacaggcgaaacctctgaacgtgaagtgaccttgtcaaaagacgaaggt
aaccgccctgaaacaacactagaagggcttaaggcgctaaacccagtaatagaaggcggt
tgtattaccgcaggtaatgccagtcagctttctgatggtgcaagtgcgacagtaattatg
gatgagcaaacagcagcgaagggcaacgctcaacctcttggtatttatcgcggtattgca
gtggccggctgtgagccagatgaaatgggaattggcccagtgttcgctattcctaagcta
ttaaagcagcatggattgaccatggacgatatcggtctatgggagcttaatgaagcgttt
gcagtacaggtactgtattgccgcgataagttaggcattccagacgaattattgaacgta
aacggcggtgccatttctattggtcacccatacggcatgagcggtgctcgcatggtgggt
catgcactcatcgaaggtaaacgacgcggtgcgaaatatgttgtttgcaccatgtgtatc
ggtggcggcatgggcgctgctggtctatttgaagtaatatag

DBGET integrated database retrieval system