KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_08550Help
Entry
AMBLS11_08550     CDS       T02260                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00010  Glycolysis / Gluconeogenesis
amk00051  Fructose and mannose metabolism
amk00562  Inositol phosphate metabolism
amk01100  Metabolic pathways
amk01110  Biosynthesis of secondary metabolites
amk01120  Microbial metabolism in diverse environments
amk01130  Biosynthesis of antibiotics
amk01200  Carbon metabolism
amk01230  Biosynthesis of amino acids
Module
amk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
amk_M00002  Glycolysis, core module involving three-carbon compounds
amk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMBLS11_08550
   00051 Fructose and mannose metabolism
    AMBLS11_08550
   00562 Inositol phosphate metabolism
    AMBLS11_08550
Enzymes [BR:amk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AMBLS11_08550
Exosome [BR:amk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AMBLS11_08550
  Exosomal proteins of bladder cancer cells
   AMBLS11_08550
  Exosomal proteins of melanoma cells
   AMBLS11_08550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFT78291
UniProt: K0D2Z7
Position
2028812..2029555
Genome map
AA seq 247 aa AA seqDB search
MSKNLRKPFVAGNWKMNGNLALVAEFNQKLANVKAESEIVICAPSLLLHAFETQSFAIGA
QNVSHLNNGAHTGELSVEMLKEAGCGYAIVGHSERREDQGESSKLVALKAKQCVSSGVVP
IICVGEPLEVREAGNVEAYVGEQLDALIDAMSVEELSKTVIAYEPIWAIGTGKTASPEQA
QEVHEFIRGYFAKVDAQLAQGLRILYGGSVKPDNAKTLFAQNDVDGGLIGGASLKAEDFI
SICQAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaaatcttagaaagccattcgtggctggcaactggaaaatgaatggaaatttg
gcattagttgctgaattcaatcaaaaattagcgaacgtaaaagctgaatcggaaatcgta
atttgcgctccttcacttcttttacacgcatttgaaacccagtcatttgccattggcgct
caaaacgtaagtcatctgaataacggcgctcacactggtgagttgtctgttgaaatgctt
aaagaggcgggttgtggttacgcaatcgtcgggcattctgaaagacgagaagaccaaggc
gagtcaagcaaacttgttgcattaaaggcgaaacagtgcgtttcctctggtgttgtacct
atcatttgtgtaggtgagccactagaagtaagagaagcaggcaacgtcgaggcatacgtt
ggtgaacaactagatgcgcttattgatgccatgtctgttgaagaacttagcaagactgtt
attgcatatgagccgatttgggcaataggtactggtaaaacagctagcccagaacaagca
caagaagtacacgaatttattcgcggctactttgcaaaagtagacgcacaattggctcaa
ggccttcgtattttatacggtggtagtgttaagccagacaatgctaaaaccctgtttgct
cagaacgatgtagatggtggtttaattggcggagccagtttaaaagctgaagattttatt
tcaatttgccaagcggcaaactga

DBGET integrated database retrieval system