KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_11325Help
Entry
AMBLS11_11325     CDS       T02260                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00450  Selenocompound metabolism
amk00970  Aminoacyl-tRNA biosynthesis
amk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AMBLS11_11325 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AMBLS11_11325 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amk01007]
    AMBLS11_11325 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:amk03016]
    AMBLS11_11325 (metG)
Enzymes [BR:amk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AMBLS11_11325 (metG)
Amino acid related enzymes [BR:amk01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AMBLS11_11325 (metG)
Transfer RNA biogenesis [BR:amk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AMBLS11_11325 (metG)
 Prokaryotic type
   Other AARSs
    AMBLS11_11325 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DALR_1
Motif
Other DBs
NCBI-ProteinID: AFT78842
UniProt: K0D570
Position
2666746..2668773
Genome map
AA seq 675 aa AA seqDB search
MSEKRRILVTSALPYANGSIHLGHLLEHIQTDIWTRFQRLRGNECYSVCADDAHGTPVML
KAQELGITPEEMVARTRAEHHQDLVDFHVDYDNYYVTHSPENKALCEEIYTRLDNAGYIS
KRTINQLFDPEKEMFLPDRFVKGTCPSCGAEDQNGDSCDVCGATYSPTEVKNPRSVVSGA
TPVLRESEHFFFDLPKFEGMLKEWIRSGALQEEMANKLQEWFTEGLQQWDISRDAPYFGF
EIPGAPNKFFYVWVDAPVGYMASFKNFCDQNNLEFDDFWKADSDAELYHFIGKDITYFHC
LFWPAMLEGAGYRKPTGVNIHGFVTVNGAKMSKSRGTFIKGRTYLDHLNPEYLRYYFASK
LGDGVTDIDLNFTDFAQKVNSDLVGKVVNIASRCASFITKRFDGKLSDNVIEPELIAEFQ
NASESIAALFEKRKYHQAVREIMALADKANQFIDNNAPWVTIKDETKQQFTHDVCSLGIN
MFRLLVIYLKPVLPVLAEKAEEFLNDKFDWNSLQTLLKGHGINKFKPMMQRVEMEKIDAM
VEDSKESLAPAAPAIDPDSPLAKDPISDTISFDEFAKVDLRIARIAKAEHVEKADKLLRL
ELDLGGETKQVFAGIKSAYSPEALIGKHTVMVANLAPRKMRFGMSEGMVLAAGPGGDELY
ILEPHEGAKPGMRVK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaaacgccgaattctggtaaccagtgcgttgccatacgcaaatggctctatt
cacttaggtcatttgctagaacacattcaaaccgacatctggactcgttttcagcgcctt
cgcggaaacgaatgttacagtgtttgcgccgacgatgcacacggtacgccggttatgctt
aaagcccaagagcttggcattacaccagaagaaatggtggcaagaacgcgtgctgaacat
caccaagaccttgttgattttcacgtagattacgacaactactatgtaacccattcgcca
gaaaacaaggcgctgtgtgaagaaatttacacccgtttggataatgcgggttacatcagc
aagcgtaccattaaccaactgttcgaccctgaaaaagaaatgttcttgccggatcgtttc
gttaagggcacctgcccaagctgtggcgcagaagatcaaaacggcgacagctgcgacgtg
tgtggtgcaacctacagcccgactgaagtgaaaaacccgcgcagcgttgtatcgggtgct
acaccagtactacgtgagtctgagcactttttctttgacctaccaaaatttgaaggcatg
ttgaaagagtggatccgctcaggtgcccttcaagaagaaatggctaacaagctacaagag
tggttcactgaaggccttcagcagtgggacatcagccgtgacgcgccgtatttcgggttt
gaaattccaggtgcgccgaacaagttcttctacgtgtgggtagatgcacctgttggctac
atggcaagtttcaaaaacttttgcgaccaaaacaatctagagtttgatgacttctggaaa
gcagactcagacgctgagctttatcactttataggtaaagatattacctacttccactgc
ctgttctggcctgccatgctagaaggcgcgggataccgtaagcctactggcgtaaacatt
catggtttcgtaaccgtaaacggtgcgaaaatgtcaaagtcgcgcggtacatttattaaa
ggccgtacttaccttgaccacctgaatccagaatatcttcgttactactttgcgtctaag
ttaggcgacggtgttaccgacatcgaccttaactttactgacttcgcacaaaaagtgaat
tcagacctggtaggcaaagtggttaacattgctagccgctgcgctagctttatcaccaag
cgttttgacggcaaattatctgacaacgtgattgagccggagctgattgcagagttccaa
aacgcgtcagagagcattgctgcacttttcgagaagcgtaagtaccaccaagccgtgcgc
gaaataatggctcttgctgataaagcgaaccagttcattgataacaatgcaccttgggta
accattaaagacgagactaagcagcagttcacacacgatgtgtgctcgctaggtatcaac
atgttccgtctgttggtgatttacttgaagcctgtgcttcctgtacttgcagaaaaagca
gaagaattcttaaacgataagttcgactggaattcacttcaaaccctattgaaaggccac
ggcatcaacaaatttaagccgatgatgcagcgtgtagaaatggagaaaatcgacgccatg
gttgaagattcaaaagaaagcctagcgccagcagcaccggcaatcgacccagacagcccg
cttgctaaagaccctattagcgatactatctcgtttgatgagttcgccaaagtagattta
cgtattgcgcgtatcgctaaagctgaacacgtggaaaaagccgataagcttctgcgcttg
gagctagatttaggcggcgaaaccaagcaagtttttgcaggtattaagtcggcttactcg
cctgaagccctaattggtaagcacacagtaatggtggcgaacctcgctcctcgtaaaatg
cgttttggcatgagtgaaggcatggtattagccgcgggccctggtggcgacgagctatac
attcttgagccgcacgaaggtgcaaagccgggtatgcgcgttaagtaa

DBGET integrated database retrieval system