KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_11620Help
Entry
AMBLS11_11620     CDS       T02260                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00071  Fatty acid degradation
amk00280  Valine, leucine and isoleucine degradation
amk00281  Geraniol degradation
amk00310  Lysine degradation
amk00360  Phenylalanine metabolism
amk00362  Benzoate degradation
amk00380  Tryptophan metabolism
amk00410  beta-Alanine metabolism
amk00627  Aminobenzoate degradation
amk00640  Propanoate metabolism
amk00650  Butanoate metabolism
amk00903  Limonene and pinene degradation
amk00930  Caprolactam degradation
amk01100  Metabolic pathways
amk01110  Biosynthesis of secondary metabolites
amk01120  Microbial metabolism in diverse environments
amk01130  Biosynthesis of antibiotics
amk01212  Fatty acid metabolism
Module
amk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMBLS11_11620
   00650 Butanoate metabolism
    AMBLS11_11620
  Lipid metabolism
   00071 Fatty acid degradation
    AMBLS11_11620
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMBLS11_11620
   00310 Lysine degradation
    AMBLS11_11620
   00360 Phenylalanine metabolism
    AMBLS11_11620
   00380 Tryptophan metabolism
    AMBLS11_11620
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMBLS11_11620
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMBLS11_11620
   00281 Geraniol degradation
    AMBLS11_11620
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMBLS11_11620
   00627 Aminobenzoate degradation
    AMBLS11_11620
   00930 Caprolactam degradation
    AMBLS11_11620
Enzymes [BR:amk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMBLS11_11620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFT78897
UniProt: K0D5B2
Position
complement(2738627..2739466)
Genome map
AA seq 279 aa AA seqDB search
MKYSTLEVKQEGHIAHVVLNRPDAMNSMIPEFWTELPAAIREIDDEGKARVIVISSTGKH
FSAGMDLSVFLNMKEDFKGDPSRRAERMRRMVMLLQDSFTAIEQARMPVIGAVQGGAIGG
AVDLLSACDMRYCTQDAFFTIKETQLGMTADVGTLQRLPKLIPIGIVKELAYTGRNFGAA
EAQQLGFVNQVFDNHDSMLDAVMKIAQQIAMNSPLAVSGTKTMINYAVEHTVAESLTYMA
TWQAGMFQMEDVFKAMEAQKTKTLPEYPPLHPAIKKMNS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagtactctacattagaagtaaaacaagagggccatattgcccacgtagtactcaat
cgccccgatgcaatgaacagcatgatccctgaattctggacagagctgccggcggccatc
cgtgaaatagatgatgaaggcaaagcccgcgtcattgttatttcatcaacaggtaagcat
ttctctgccggtatggatttatctgtatttttgaatatgaaggaagattttaagggcgac
ccgtcgcgcagagcggaacgcatgcgacgtatggttatgctgctacaagatagcttcaca
gctatagagcaggctcgtatgcctgttattggcgcagttcagggcggcgcaattggcggg
gcggttgacctacttagtgcatgcgacatgcgctattgcacacaagatgcttttttcact
ataaaagaaacgcaattgggcatgaccgccgatgtcggcactctacaaagactaccaaag
cttattcccattggtattgtcaaagaactcgcctatacagggcgcaactttggtgccgca
gaagcgcagcaacttgggtttgttaatcaggtcttcgacaaccacgattctatgctagac
gcggtaatgaaaatagcacagcaaattgctatgaattcgccgttagcggtgtcaggtacc
aaaaccatgattaattatgcggtagagcatacggtggcagaaagcttaacttatatggct
acttggcaagcgggcatgttccagatggaagatgtgtttaaagccatggaagcccagaag
accaaaacactaccggaatatccgcctcttcatccggctattaaaaagatgaattcatag

DBGET integrated database retrieval system