KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_13040Help
Entry
AMBLS11_13040     CDS       T02260                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00220  Arginine biosynthesis
amk00250  Alanine, aspartate and glutamate metabolism
amk00471  D-Glutamine and D-glutamate metabolism
amk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMBLS11_13040
   00220 Arginine biosynthesis
    AMBLS11_13040
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AMBLS11_13040
Enzymes [BR:amk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     AMBLS11_13040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase TT_ORF2a
Motif
Other DBs
NCBI-ProteinID: AFT79179
UniProt: K0CZZ8
Position
complement(3042412..3043320)
Genome map
AA seq 302 aa AA seqDB search
MLALLQDIYDEVEPMLGMGKVADYIPALATVNPRQFGISICDTNGEITSIGDASVPFSIQ
SISKVFNLVLAINHYGETMWERVGCEPSGLPFNSLVQLEYENGIPRNPFINAGALVVSDM
VQSRFASPYIAMRDFVRRLSCNGDIVVNKVVAESEYEHRSRNAAMAYLMKAYGNFENDVE
DVLRNYFHNCALEMSCEDLARSTSFLANAGFSTCANQRVLTPYQTKQVNALLATSGMYDE
AGSFAFKVGLPGKSGVGGGIVAVVPGRFSICVFSPALNSVGNSQLGVAALTSLSERINWS
IY
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctggctttacttcaagatatatacgatgaagttgaacctatgttgggtatggggaaa
gttgccgactatattccagcactggccaccgtcaacccaagacagtttggcatttcaatt
tgcgatactaacggtgaaatcacctctataggcgatgcgagtgttcctttttctatccaa
agtatttcaaaagtctttaatcttgtgctggccatcaaccactatggtgaaaccatgtgg
gagcgagttggctgcgaaccatctggcctgccgtttaactctttagtgcaattagaatac
gaaaacggcattcctcgtaacccttttataaacgcaggcgcgctggttgtaagtgacatg
gtgcaatctcggtttgcctcgccctatattgccatgcgagattttgtaaggcgcttaagc
tgtaacggtgacatagtggtgaataaggtggtggctgaatcggagtacgagcaccgctct
cgcaatgcggcaatggcgtatttgatgaaggcctatggaaacttcgaaaatgacgttgaa
gatgtgctacgaaactactttcacaactgcgcattagaaatgagttgtgaagacctggcg
cgttcaactagctttcttgccaatgcagggttttcaacctgtgccaaccaacgtgtgcta
accccatatcaaactaaacaggtgaacgcacttttggcaaccagtggtatgtatgacgaa
gcggggagtttcgcttttaaagtaggtttaccgggtaaaagtggcgtgggtggtggtatt
gtagctgttgtgcctgggcgcttttctatatgtgtattttcaccggcccttaatagcgtg
gggaattctcaactaggcgtggcagccttaacgtccttaagtgaacgcataaactggtct
atttattaa

DBGET integrated database retrieval system