KEGG   Ailuropoda melanoleuca (giant panda): 100462659
Entry
100462659         CDS       T01329                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma precursor
  KO
K04687  interferon gamma
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03050  Proteasome
aml04060  Cytokine-cytokine receptor interaction
aml04066  HIF-1 signaling pathway
aml04217  Necroptosis
aml04350  TGF-beta signaling pathway
aml04380  Osteoclast differentiation
aml04612  Antigen processing and presentation
aml04630  JAK-STAT signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04940  Type I diabetes mellitus
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05143  African trypanosomiasis
aml05144  Malaria
aml05145  Toxoplasmosis
aml05146  Amoebiasis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05164  Influenza A
aml05168  Herpes simplex virus 1 infection
aml05200  Pathways in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05321  Inflammatory bowel disease
aml05322  Systemic lupus erythematosus
aml05323  Rheumatoid arthritis
aml05330  Allograft rejection
aml05332  Graft-versus-host disease
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100462659 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100462659 (IFNG)
   04630 JAK-STAT signaling pathway
    100462659 (IFNG)
   04066 HIF-1 signaling pathway
    100462659 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100462659 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100462659 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100462659 (IFNG)
   04612 Antigen processing and presentation
    100462659 (IFNG)
   04660 T cell receptor signaling pathway
    100462659 (IFNG)
   04658 Th1 and Th2 cell differentiation
    100462659 (IFNG)
   04659 Th17 cell differentiation
    100462659 (IFNG)
   04657 IL-17 signaling pathway
    100462659 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100462659 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462659 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100462659 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100462659 (IFNG)
   05323 Rheumatoid arthritis
    100462659 (IFNG)
   05321 Inflammatory bowel disease
    100462659 (IFNG)
   05330 Allograft rejection
    100462659 (IFNG)
   05332 Graft-versus-host disease
    100462659 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100462659 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100462659 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100462659 (IFNG)
  09172 Infectious disease: viral
   05164 Influenza A
    100462659 (IFNG)
   05160 Hepatitis C
    100462659 (IFNG)
   05168 Herpes simplex virus 1 infection
    100462659 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100462659 (IFNG)
   05144 Malaria
    100462659 (IFNG)
   05145 Toxoplasmosis
    100462659 (IFNG)
   05140 Leishmaniasis
    100462659 (IFNG)
   05142 Chagas disease
    100462659 (IFNG)
   05143 African trypanosomiasis
    100462659 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:aml03051]
    100462659 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100462659 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100462659 (IFNG)
Proteasome [BR:aml03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100462659 (IFNG)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Interferons
   100462659 (IFNG)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Haparin
  Cytokines
   100462659 (IFNG)
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 100462659
NCBI-ProteinID: NP_001291792
Ensembl: ENSAMEG00000008725
UniProt: C8CBV8
AA seq 166 aa
MNYTSYILAFQLCVILCSSGYYCQAMFFKEIENLKEYFNASNPDVADGGPLFLDILKNWR
EESDKTIIQSQIVSFYLKLFENFKDNQIIQRSMDTIKEDMLFKFFNSSTSKRSDFLKLIQ
IPVNDMQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaattatacaagctatatcttagctttccagctttgcgtgattttgtgttcttcaggc
tattactgtcaggccatgttttttaaagaaatagaaaacctgaaggaatattttaatgca
agtaatccagatgtagcggatggtggccctcttttcttagatattttgaagaactggaga
gaggagagtgacaaaacgatcattcaaagccaaatcgtctccttctacttgaaactgttt
gaaaactttaaagataaccagatcattcaaaggagcatggataccatcaaggaagacatg
cttttcaagttcttcaacagcagtaccagtaagcggagtgacttccttaagctgattcaa
attcccgtgaatgatatgcaggttcagcgcaaagcgataaatgaactcatcaaagtgatg
aatgatctctcaccaagatctaacctgaggaagcggaaaaggagtcagaatctgtttcga
ggccgcagagcatcgaaataa

DBGET integrated database retrieval system