KEGG   Ailuropoda melanoleuca (giant panda): 100463583Help
Entry
100463583         CDS       T01329                                 

Gene name
ARG1
Definition
(RefSeq) arginase 1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00220  Arginine biosynthesis
aml00330  Arginine and proline metabolism
aml01100  Metabolic pathways
aml01230  Biosynthesis of amino acids
aml05146  Amoebiasis
Module
aml_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100463583 (ARG1)
   00330 Arginine and proline metabolism
    100463583 (ARG1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100463583 (ARG1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100463583 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 100463583
NCBI-ProteinID: XP_011227939
Ensembl: ENSAMEG00000010227
Position
Un
AA seq 322 aa AA seqDB search
MSSKSKFIGIIGAPFSKGQPRGGVEEGPAALRKAGLLEKLKEQECDVKDYGDVPFVDVPS
DPPFQIVKNPRSVGKANEQLAGVVAEVKKNGRTSLVLGGDHSMAVGSISGHARVHPDLCV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDKLGIGKVMEEALSYLLGRKKRRIHLSFDVDGLDPSF
TPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT
LSCFGVAREGNHKPIDYLNPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaagtcaaaattcatagggatcatcggagcgcctttctcgaagggccagcca
cgaggaggggtggaagaaggccccgcagcattgagaaaggctggcctgcttgagaaactg
aaagaacaagagtgtgatgtgaaagattacggggacgtgccctttgttgatgtccctagt
gatcctccctttcaaattgtgaagaatccaaggtccgtgggaaaagcgaatgagcagctg
gctggcgtggtggcggaagtcaagaagaatggaaggactagcctggtgctgggcggagac
cacagtatggcggttggaagcatctctggccatgccagggtccacccagatctctgtgtc
atttgggtggacgctcacaccgatatcaacactccactgacaaccacaagtgggaacttg
cacggacaaccggtgtcttttctcctgaaggaactaaaaggaaagatccccgatgtacca
ggattctcctgggtgactccctgcatatctgccaaagatattgtgtatattggcctgaga
gacgtggaccctggggaacactacattttgaaaactctgggtattaaatatttttcaatg
actgaagtggataaactgggaattggcaaggtgatggaagaagccctcagctatctacta
ggaaggaaaaaaaggcgaattcatctgagctttgatgttgatggattggacccatctttc
acaccagctacgggcacaccagttgtgggaggtctgtcttacagagaaggtctctacatt
acagaagaaatttacaaaacagggctactctcaggattagatataatggaagtgaacccc
tctctggggaagacaccagaagaagtaactcgaacagtgaacacagcagtagcaataacc
ttgtcttgctttggagttgcacgggagggtaatcataagccaattgactaccttaaccca
cctaagtaa

DBGET integrated database retrieval system