KEGG   Ailuropoda melanoleuca (giant panda): 100463658Help
Entry
100463658         CDS       T01329                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100463658 (DOCK8)
Membrane trafficking [BR:aml04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100463658 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N GPR15L
Motif
Other DBs
NCBI-GeneID: 100463658
NCBI-ProteinID: XP_011224116
Ensembl: ENSAMEG00000006698
Position
Un
AA seq 2033 aa AA seqDB search
MTHLNSLDVELAQELEDFTEDDLDVLFTPKECRTLQPSLPEEGVELDPHVRDCVQTYIRE
WLIVNRKNQGSSEICGFKKTGSRRDFHKTLQKQTFESESLESREPSTQARPRHLNVLCDV
SGKVPLTACGFDLRSLQPDQRLENLLQQVSAEDFEKQNEEARRTNRHAELFALYPSVDEE
DAVEIRPVPECPKEHLGNRILVKVLTLKFEIEIEPLFASIALYDVKERKKISENFHCDLN
SDQFKGFLRAHTPSVAPSSQAKSAVFSVTYPSSDIYLVVKIEKVLQQGEIGDCAEPYMVI
KEGDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLTSFFNVSTLEREVTDVESMV
GRSSVGERRTLSQSRRLSERALSLEENGVGSNYKTTTMTVNSFFKQEGDRLSDEDLFKFL
ADYKRSSSLQRRVKSIPGLLRLEISSAPEIINCSLTPEMLPVKPFPENRTRPHKEILEFP
IREVYVPHTVYRNLLYVYPQRLNFANKLASARNITIKIQFMCGEDASNAMPVIFGKSNGP
EFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVESLLGY
SWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQA
VSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKISETSLEHELKLSLICLNSSRLEPL
VLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLAKDQHGRNCLL
ASYVHYVFRLPEPPRDPPKSGGAATLPDPRYHTYGRTSAAAVSSKLLQARVMSSSNPDLA
GTHCAADEEVKNIMSSKNADRNCNRMSYYCSGNNDVPGSTATPRPASKKHFHEELALQMV
VSTGMVRETVFKYAWFFFELLVKSMAQYVHNMDKRDNFRRTRFSDRFKDDITTIVNVVTS
ETAALLVKPQKENEQAEKINISLAFFLYDLLSLMDRGFVFNLIKHYCNQLSAKLTNLPTL
ISMRLEFLRILCSHEHYLNLNLFFMNADTAPASPCPSISSQNSSSCSSFQDQKIASMFDL
TPEYRQQHFLTGLLFTELVAALDAEGEGISKVQRKAVSAIHSLLSSHDLDPRCVKPEVKV
KIAALYLPLVGIILDALPQLYDFTAADARSGKNRANGSDEDQEGISAINQNMALAIAGNN
FTSKTSGTMLSSLPYKQYNMLSADTTRNLMICFLWIMKNADQSLIKKWIADLPSMQLNRI
LDLLFICVSCFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMRRCRAPGN
DRFPGLSENLRWRKEQTHWRQANEKQDKTKAELDQEALISGNLATEANLIILDMQENIIQ
ATSALDCKDSLLGGVLRVLVNSLSCDQSTTYLTHCFATLRALIAKFGDLLFEEEVEQCAD
LCQRVLHHCSSSMDVTRSQACATLYLLMRFSFGATSNFARVKMQVTMSLASLVGKAPDFN
EEYLRRSLRTILAYAEEDIAMQATPFPTQVEELLCNLNSILYDTVKMREFQEDPEMLMDL
MYRIAKSYQTSPDLRLTWLQNMAEKHTKKKCYTEAAMCLVHAAALVAEYLSMLEDHSYLP
VGSVSFQNISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEHAAELFSTGGLYE
TVNEVYKLVIPILEAHRDFRKLTSTHDKLQKAFDSIISKGHKRMFGTYFRVGFYGSKFGD
LDEQEFVYKEPAITKLPEISHRLEGFYGQCFGEEFVEVIKDSAPVDKTKLDPNKAYIQIT
FVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELQEQYRRNTVLTTMHAFP
YVKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAIHQEPPDAKMLQMVLQGSVGATVN
QGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQREYQQEL
KKNYHKLKENLRPMIERKIPELYKPIFRVESHKRDSFHRSSFRKCETQLSQGS
NT seq 6102 nt NT seq  +upstreamnt  +downstreamnt
atgacccacctgaacagcctggatgtggagctcgcccaggagctggaagacttcaccgag
gacgacttggacgtgttgttcacgccaaaggaatgtcgcactttgcagccctctttgccg
gaggaaggggttgaactggaccctcatgtcagggactgtgttcagacttatattcgggaa
tggctaatcgtgaaccgaaaaaaccaaggaagttcggagatttgcggctttaaaaagact
ggatcccgaagagattttcacaagacacttcagaaacagacatttgagtcagagtccttg
gagagccgtgaaccaagcacacaggcgcgtccccgccacttaaacgtgctgtgcgacgtg
tctgggaaagtgcccctcactgcctgtggcttcgaccttcgcagcctgcagcccgatcag
cggctggagaacctgctgcaacaagtgagtgctgaggacttcgagaagcagaatgaagag
gcccggaggaccaatcggcatgccgagctctttgctctgtacccatcggtggatgaggag
gatgctgtggaaatacgtccggtgccagaatgtcctaaggaacatctgggcaacagaata
ctggtcaaggtcctgaccctgaagtttgagattgaaattgagcctctgtttgccagcatc
gccctctacgatgttaaagaaaggaaaaagatctcagaaaattttcactgtgacctgaac
tctgaccagttcaaaggctttctgcgtgctcacacgccctccgtggctccatcaagtcag
gcaaaatctgcagtcttctcggtcacgtacccatcctcggacatctatctagttgtcaag
attgaaaaagtccttcagcagggagagattggagactgtgcagaaccatacatggttatc
aaagaaggtgatggtggaaagagtaaagaaaagattgaaaaactaaaacttcaagctgaa
tccttctgccagcgtttggggaaataccggatgccttttgcctgggctcccataagctta
acaagtttcttcaatgtctccaccctggagagggaggtaaccgatgtggagtccatggtt
gggagaagctctgtgggtgagcggagaactctgtcccaatctagaaggctttctgaaaga
gctctctccttggaggaaaatggggttggatccaactacaagaccaccaccatgactgtt
aacagctttttcaagcaggagggggatcgcctcagtgatgaagacctattcaagtttttg
gctgactacaaaagatcttcgtccttacagagaagagtcaagtcgattccaggcttgctc
agactggaaatttcttcagctccagagatcatcaattgctctctgactcctgaaatgctg
ccagtgaaaccttttcctgaaaaccggacacgtccgcacaaagagattttggaatttcca
atccgggaagtctatgtccctcatactgtgtatagaaatcttctctacgtctacccacag
aggctgaactttgctaacaaactggcatccgcccggaacatcacaataaagatccagttt
atgtgcggagaggatgctagcaatgctatgccggtcatctttggaaaatccaatggccct
gaatttctgcaggaagtgtacacagctattacataccataataagtctcctgacttctat
gaagaagtgaaaatcaagctccccgcgaagctcacagtaaatcaccacctcctgttcact
ttctatcatatcagctgtcagcagaagcagggagcctctgtggaaagtcttctgggctat
tcgtggctgccaattctcctaaatgaacgtcttcaaactggatcctactgtctcccagtt
gccttggaaaagctgccgcccaattactccatgcattctgcagagaaagtccctttacag
aatcctcccattaagtgggctgaaggacacaagggagtgttcaacattgaagtgcaagcg
gtttcttctgttcacacccaggacaaccacctggagaagttcttcaccctctgccactcc
ctggagagccaggtgacattccccatccgcgtgctggaccagaagatcagtgagacatcc
ctggagcacgagctgaaactcagcctcatctgcctgaactcctcccgcctggagcccctg
gtgctcttcctgcacctggtgctggacaagctcttccagctgtccgtgcagcccatggtc
attgccggccagacagccaacttctcccagtttgcatttgagtctgtggtggccatagcc
aacagtctgcacaacagcaaggacctggccaaggaccagcatgggaggaactgcctgctg
gcctcctatgtgcattacgtcttccgcctgccggagcccccgagggacccacccaagtca
ggtggtgccgccaccctccctgacccacgctaccacacgtatggacgcacgtctgctgct
gctgtgagttcgaagctgctgcaggcccgggtgatgagcagcagtaatccagacctcgcg
gggacacactgtgcggccgacgaggaagtgaagaacatcatgtcttcaaagaatgctgat
cgcaattgcaatcggatgtcctactattgctcgggcaataatgacgttcctggttcgacc
gcaaccccaaggccagccagcaaaaagcatttccacgaggagcttgccctgcagatggtg
gtcagcactgggatggtgagagaaaccgtcttcaagtatgcctggttcttctttgagctt
ctggtgaaaagcatggcgcagtacgtacataacatggacaaacgggacaattttcggagg
actcgtttttccgaccgtttcaaagatgacataactactattgttaatgtggtcacctcg
gagactgcagcccttttagtgaaacctcagaaggaaaatgaacaggcagaaaagatcaac
atcagcctggctttcttcttgtatgatctcctctcactcatggatcgtggctttgtattt
aacctcatcaaacattattgtaaccagctgtcggccaagctcaccaaccttcccacgctc
atttccatgaggctggagtttctgagaatcctctgcagccatgagcattacctcaatctg
aacctcttctttatgaacgctgatactgctccagcctccccgtgcccctccatctcttcc
cagaactcgagctcctgctccagcttccaggaccagaagattgccagcatgttcgatctt
actcccgagtaccgtcagcagcactttctcacgggacttctctttacagaactggttgct
gctctggatgccgaaggcgaagggatcagcaaagtgcaaaggaaggctgtcagtgccatc
catagccttctgagctctcacgacctggacccgcgctgtgtcaaaccggaagtgaaggtc
aaaatcgctgccctctacctgcctttggttggcataattttggatgctttgccgcaactc
tatgactttacagctgcagatgcccgtagtggaaaaaatcgtgccaatggctccgatgaa
gaccaggaagggatcagtgcaattaaccagaacatggcactggccatagccggaaacaat
tttacttcgaagacaagtggaacaatgctttcttccttgccctacaagcagtacaacatg
ctgagtgccgacacgacccgcaacctcatgatctgcttcctctggatcatgaagaacgcc
gaccagagcctcatcaagaagtggatcgccgacctgccatccatgcagctaaacaggatc
ttagatctccttttcatctgtgtctcgtgcttcgagtacaagggaaaacagagttctgac
aaagtcagtacccaagtcctgcagaagtcaagggacgtcaaggccaggctggaagaggct
ttgctccgcggggaaggggcccggggggagatgatgcggcgttgccgagctccagggaat
gaccggtttccaggcctcagtgaaaatttgagatggaggaaggagcagacacattggcgg
caagctaatgagaagcaagataaaacaaaggcagagttagatcaagaagccctgatcagt
ggcaatctggctacagaagcaaatttaatcatcctggatatgcaggagaacattatccag
gcaacctcggctctggactgtaaagacagcctgctgggaggtgttctaagggtcctggtg
aattctctgagctgcgatcagagcaccacctacctgactcactgctttgcgacactccgg
gctctcattgccaagttcggggacttgctgtttgaggaggaggtggagcagtgtgcagac
ctgtgccagcgagtcttacaccactgcagcagcagcatggacgtcacccggagccaagcc
tgtgccaccctctacctcctcatgaggttcagctttggagccaccagtaactttgcaaga
gtgaagatgcaagtcaccatgtctctggcatctttggtgggcaaagcaccagactttaac
gaggagtacctgagaagatccttgaggacgatcttggcctatgcagaagaggacatagcc
atgcaggccactcctttccccacccaggtggaagaacttctctgcaatctgaacagcatc
ttatatgacacggtgaaaatgagggaatttcaggaagatcccgagatgcttatggatctc
atgtacagaattgccaagagttaccagacctctcctgacctgcggctgacctggcttcag
aacatggccgagaaacacaccaagaagaaatgctacacggaggccgccatgtgcctggtg
cacgcggctgccttagtggccgagtacctgagcatgctggaggaccacagctacctgccc
gtgggcagcgtcagttttcagaacatttcttccaacgtgctggaggagtctgcggtctca
gatgacaccttgtcacccgatgaggacggcgtgtgttcgggccggtacttcaccgagagc
ggcctggtgggcctcctggagcatgccgctgaactcttcagcacgggaggattgtacgag
acggttaatgaggtctacaagctggtcattcccatcctggaagcacacagagacttccgg
aagctgacctccacccatgacaagctgcagaaggcttttgacagcatcattagcaagggt
cacaagagaatgtttgggacttacttccgagttggtttctatggatccaaatttggggat
ttagatgagcaggaatttgtttacaaagagcctgctattaccaagcttcctgagatctct
cacagactagagggattttatggccagtgtttcggtgaggaatttgtggaagtgataaaa
gactctgctcctgtggacaaaaccaagttggatcctaacaaggcctacatacagatcact
ttcgtggagccctactttgatgagtatgagatgaaagacagggtaacgtactttgagaag
aatttcaatctgcgacggttcatgtacaccaccccgttcaccctggaggggcggccccgg
ggagagctgcaggagcagtaccggcggaacaccgtcctcaccaccatgcacgccttcccc
tacgtcaagaccaggatcagcgtcatccagaaggaagagtttgttttgacaccaattgaa
gttgccattgaagatatgaagaagaagaccttgcagttagctgttgccattcaccaggag
ccccccgatgccaagatgcttcagatggtgctgcagggctctgtcggagctactgtaaat
cagggcccactggaagtagcccaagtgttcttggccgaaattccagctgacccaaagctc
tatcgacatcacaacaagctgagattatgctttaaggaattcataatgcggtgcggtgag
gccgtagagaaaaacaagcgtctcatcacggccgaccagagggagtatcagcaggaactc
aaaaagaactaccacaagctgaaagagaacctcaggccaatgatcgagcggaaaattcca
gaactctacaagccaatattcagagttgagagtcacaagagagactccttccacagatct
agtttcaggaaatgtgaaacccagttgtcacagggcagctag

DBGET integrated database retrieval system