KEGG   Ailuropoda melanoleuca (giant panda): 100464055Help
Entry
100464055         CDS       T01329                                 

Gene name
NELFA
Definition
(RefSeq) negative elongation factor complex member A
  KO
K15179  negative elongation factor A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aml03021]
    100464055 (NELFA)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    NELF complex
     100464055 (NELFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CathepsinC_exc
Motif
Other DBs
NCBI-GeneID: 100464055
NCBI-ProteinID: XP_019652313
Ensembl: ENSAMEG00000014240
Position
Un
AA seq 460 aa AA seqDB search
MKGALAEIIQLATLDSDPWVLMVADILKSFPDTGSLNLDLEEQNPNVQDILGELREKVNE
CEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQKSTETAQQLK
RSAGVPFHAKGRGLLRKMDTTTPLKGIPKQAPFRSPTTPSVFSPAGNRTPIPPSRTPLRK
ERGVKLLDISELDMVGAGREAKRRRKTLDAEVVEKPAKEETVVENATPDYAAGLVSTQKL
GSLNSEPALPSTSYLPATPSAVPASSYVPSSESPAAPSSREAGLXXXXEEASTPSPALPA
QFKQRAPMYNSGPSPAASAPSTPTSPLTPTTPPAVTPAAQTPPVAMVAPQTQPPAQQQPK
KNLSLTREQMFAAQEMFKTANKVTRPEKALILGFMAGSRENPCQEQGDVIQIKLSEHTED
LPKSDGQGSTTMLVDTVFEMNYATGQWTRFKKYKPMANVS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgccctggcggagattatccagctcgccaccctggactcggacccctgggtt
ctcatggtagctgacatcctgaagtcctttcccgacacaggctcgcttaaccttgacctc
gaagagcagaatcccaacgttcaagatattttaggagaacttagagaaaaggtgaacgag
tgtgaagcgtccgccatgctgccactggagtgccagtacttgaataaaaacgccctgacg
accctcgccggacccctcactcccccagtgaaacatttccagttaaaaaggaaaccgaag
agcgccacgctgagggcagagctcctgcagaaatctaccgagacggcccagcagctgaag
aggagcgcgggggtgcccttccacgccaagggccgggggctgctccggaagatggacacc
acaaccccgctcaaaggcatcccgaagcaggcacccttcagaagtcccaccacccccagt
gtcttcagccctgccgggaaccggacccccatcccaccttcgaggactcctctgcggaag
gagaggggagtgaagctgcttgacatttctgagctggatatggtgggtgccggccgagag
gcaaagaggaggaggaagacgctggatgcggaagtggtggaaaagccggccaaggaggag
accgtcgtggagaacgccacccccgattacgcagctggcctggtgtccacacagaaactt
gggtccttgaacagcgagcccgcgctgccctccacaagctacctgcccgccacacccagc
gcggtcccggcctcgtcctacgtccccagctccgagagcccggcagcaccgtcttctcgg
gaagccggcctgncnnnnnnnncggaggaagccagtacccccagccccgcgctgccggcg
cagttcaagcagagggcccccatgtacaacagcggcccaagcccagccgcatctgcgcct
tcgacgcccacctctcccctgacacccaccacacccccagccgtcaccccggccgcccag
acacctccggtggccatggtggccccacagacccagccccctgcccagcagcagcccaag
aagaacctgtccctcacgagagagcagatgttcgctgcgcaggagatgttcaagacggcc
aacaaagtcacacggcccgagaaggccctcatcctgggcttcatggccggctcccgagag
aacccgtgccaggagcagggcgacgtgatccagatcaagctcagcgagcacacggaggac
ctgcccaagtcggacggccagggcagcaccaccatgctggtggacaccgtgttcgagatg
aactatgccacgggccagtggacgcgcttcaagaagtacaagcccatggccaacgtgtcc
tag

DBGET integrated database retrieval system