KEGG   Ailuropoda melanoleuca (giant panda): 100465213Help
Entry
100465213         CDS       T01329                                 

Gene name
RPL23A
Definition
(RefSeq) ribosomal protein L23a
  KO
K02893  large subunit ribosomal protein L23Ae
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03010  Ribosome
Module
aml_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    100465213 (RPL23A)
Ribosome [BR:aml03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    100465213 (RPL23A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L23eN Ribosomal_L23 Ribosomal_L6
Motif
Other DBs
NCBI-GeneID: 100465213
NCBI-ProteinID: NP_001291785
Ensembl: ENSAMEG00000004684
UniProt: F2X266
Position
Un
AA seq 156 aa AA seqDB search
MAPKPKKEAPAPPKAEAKAKALKAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKY
PRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDID
VAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaagcctaagaaggaagcccctgcgcctcccaaagccgaagccaaagcaaag
gctttgaaggccaagaaagcggtgctgaaaggcgtccacagccacaaaaaaaagaagatt
cgcacgtcacctacattccgacgacccaagactctgcgtctccgaaggcagcccaaatat
cctcgaaagagcgcccccaggagaaacaagcttgatcactatgccatcatcaaattcccc
ctgactactgagtcagccatgaagaaaatagaagacaacaacacacttgtgttcattgtg
gatgtcaaggccaacaagcaccagatcaaacaggctgtgaagaagctctatgatattgat
gtggccaaggtcaacaccttgatcaggcctgatggagaaaagaaggcgtatgttcgactg
gctcccgactatgatgctttggatgttgccaacaaaattgggatcatctaa

DBGET integrated database retrieval system