KEGG   Ailuropoda melanoleuca (giant panda): 100465700Help
Entry
100465700         CDS       T01329                                 

Gene name
MAP2K2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04218  Cellular senescence
aml04270  Vascular smooth muscle contraction
aml04370  VEGF signaling pathway
aml04371  Apelin signaling pathway
aml04540  Gap junction
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04620  Toll-like receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04730  Long-term depression
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04921  Oxytocin signaling pathway
aml04926  Relaxin signaling pathway
aml04934  Cushing's syndrome
aml05020  Prion diseases
aml05161  Hepatitis B
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05167  Kaposi's sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
Module
aml_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100465700 (MAP2K2)
   04015 Rap1 signaling pathway
    100465700 (MAP2K2)
   04010 MAPK signaling pathway
    100465700 (MAP2K2)
   04012 ErbB signaling pathway
    100465700 (MAP2K2)
   04370 VEGF signaling pathway
    100465700 (MAP2K2)
   04371 Apelin signaling pathway
    100465700 (MAP2K2)
   04066 HIF-1 signaling pathway
    100465700 (MAP2K2)
   04068 FoxO signaling pathway
    100465700 (MAP2K2)
   04072 Phospholipase D signaling pathway
    100465700 (MAP2K2)
   04071 Sphingolipid signaling pathway
    100465700 (MAP2K2)
   04024 cAMP signaling pathway
    100465700 (MAP2K2)
   04022 cGMP - PKG signaling pathway
    100465700 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    100465700 (MAP2K2)
   04150 mTOR signaling pathway
    100465700 (MAP2K2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100465700 (MAP2K2)
  Cell growth and death
   04210 Apoptosis
    100465700 (MAP2K2)
   04218 Cellular senescence
    100465700 (MAP2K2)
  Cellular community - eukaryotes
   04540 Gap junction
    100465700 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100465700 (MAP2K2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100465700 (MAP2K2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100465700 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    100465700 (MAP2K2)
   04660 T cell receptor signaling pathway
    100465700 (MAP2K2)
   04662 B cell receptor signaling pathway
    100465700 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    100465700 (MAP2K2)
  Endocrine system
   04910 Insulin signaling pathway
    100465700 (MAP2K2)
   04912 GnRH signaling pathway
    100465700 (MAP2K2)
   04915 Estrogen signaling pathway
    100465700 (MAP2K2)
   04917 Prolactin signaling pathway
    100465700 (MAP2K2)
   04921 Oxytocin signaling pathway
    100465700 (MAP2K2)
   04926 Relaxin signaling pathway
    100465700 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    100465700 (MAP2K2)
   04916 Melanogenesis
    100465700 (MAP2K2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100465700 (MAP2K2)
  Nervous system
   04720 Long-term potentiation
    100465700 (MAP2K2)
   04730 Long-term depression
    100465700 (MAP2K2)
   04722 Neurotrophin signaling pathway
    100465700 (MAP2K2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100465700 (MAP2K2)
   05230 Central carbon metabolism in cancer
    100465700 (MAP2K2)
   05231 Choline metabolism in cancer
    100465700 (MAP2K2)
   05206 MicroRNAs in cancer
    100465700 (MAP2K2)
   05205 Proteoglycans in cancer
    100465700 (MAP2K2)
   05210 Colorectal cancer
    100465700 (MAP2K2)
   05225 Hepatocellular carcinoma
    100465700 (MAP2K2)
   05226 Gastric cancer
    100465700 (MAP2K2)
   05214 Glioma
    100465700 (MAP2K2)
   05216 Thyroid cancer
    100465700 (MAP2K2)
   05221 Acute myeloid leukemia
    100465700 (MAP2K2)
   05220 Chronic myeloid leukemia
    100465700 (MAP2K2)
   05218 Melanoma
    100465700 (MAP2K2)
   05211 Renal cell carcinoma
    100465700 (MAP2K2)
   05219 Bladder cancer
    100465700 (MAP2K2)
   05215 Prostate cancer
    100465700 (MAP2K2)
   05213 Endometrial cancer
    100465700 (MAP2K2)
   05224 Breast cancer
    100465700 (MAP2K2)
   05223 Non-small cell lung cancer
    100465700 (MAP2K2)
  Neurodegenerative diseases
   05020 Prion diseases
    100465700 (MAP2K2)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100465700 (MAP2K2)
  Infectious diseases
   05164 Influenza A
    100465700 (MAP2K2)
   05161 Hepatitis B
    100465700 (MAP2K2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100465700 (MAP2K2)
   05165 Human papillomavirus infection
    100465700 (MAP2K2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100465700 (MAP2K2)
   01522 Endocrine resistance
    100465700 (MAP2K2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100465700 (MAP2K2)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: STE group
  STE7 family
   100465700 (MAP2K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Seadorna_VP7 Kdo
Motif
Other DBs
NCBI-GeneID: 100465700
NCBI-ProteinID: XP_011234653
Ensembl: ENSAMEG00000002212
Position
Un
AA seq 390 aa AA seqDB search
ALTINPAIAEGPSPTSEGASEANLVDLQKKLAELELDEQQKKRLEAFLTQKAKVGELKDD
DFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYI
VGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQI
MHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDI
WSMGLSLVELSIGRYPIPPPDAKELEAIFGRPVVDGVEGEPHSISPRPRPPGRPISGHGT
DSRPAMAIFELLDYIVNEPPPKLPSGVFTQDFQEFVNKCLIKNPAERADLKMLMSHTFIK
RSETEEVDFAGWLCNTLRLNQPSTPTRAAV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gcgctcactatcaaccccgccatcgccgagggcccgtcccccaccagcgagggcgcctcc
gaagcaaacttggtggacctccaaaagaagctagcggagctagaactcgacgagcagcag
aagaagcgactggaagccttcctcacccagaaggccaaggttggggagctcaaggacgat
gacttcgaacggatctcggagctgggagccgggaacggcggggtggtcaccaaggtccag
cacagaccttccggcctcatcatggcaagaaagctgatccacctggaaatcaagccggct
atccggaaccagatcatccgcgagctgcaggtgctgcacgagtgtaactcgccgtacatc
gtgggtttctacggggccttctacagcgacggcgagatcagcatctgcatggagcacatg
gacggcggctctctggaccaggtgttgaaagaagccaagagaattcccgaggagatcctg
gggaaggtcagcattgcggttctccggggtttggcgtatctccgggaaaagcaccagatc
atgcaccgagatgtgaaaccttccaacatcctcgtcaactcccgaggggagattaagctg
tgcgattttggggtgagcggacagctcatcgactccatggccaactccttcgtgggaact
cggtcctacatgtctccagagcggttgcagggcactcactactctgtgcagtcggacatc
tggagcatgggcctgtccctggtggagctgtccatcggaaggtaccccatccccccgccg
gacgccaaggagctagaggccatatttggccggcccgtggtggacggggtagaaggagag
cctcacagcatctcaccacggccgagaccccctggacgccccatcagcggtcacgggacg
gacagccggccggccatggccatcttcgagctgctggactatatcgtgaacgagccacct
cccaagctgcccagtggcgtcttcacccaggacttccaggagtttgtaaataaatgccta
ataaagaacccagcagagcgagcggatctgaagatgctcatgagccacaccttcatcaag
cggtccgagacggaagaagtggattttgccggctggttgtgtaacacgctgcggctgaac
cagcccagcacgcccacgcgcgctgccgtgtga

DBGET integrated database retrieval system