KEGG   Ailuropoda melanoleuca (giant panda): 100466279Help
Entry
100466279         CDS       T01329                                 

Gene name
FBXO17
Definition
(RefSeq) F-box only protein 17
  KO
K10101  F-box protein 17
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aml04121]
    100466279 (FBXO17)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:aml04091]
    100466279 (FBXO17)
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100466279 (FBXO17)
Lectins [BR:aml04091]
 F-box lectins
  100466279 (FBXO17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBA F-box-like F-box
Motif
Other DBs
NCBI-GeneID: 100466279
NCBI-ProteinID: XP_019663639
Ensembl: ENSAMEG00000008717
UniProt: D2HX87
Position
Un
AA seq 277 aa AA seqDB search
MGARPSRRRLPADPPLALDALPPELLVQVLSHVPPRALVTRCRAVCRAWRDVVDGPTVWL
LQLARDRSAEGRALYAVAQRCPPNSEDEEFPLCALARYCLRAPLGRNLIFNSCGEQGFRG
WEVEHGGNGWAVEKNLTLVPGAPSQTCFVTSFQWCFKRQLVDLVMEGVWQELLDSAQIEI
CVADWWGARENCGCIYRLRVRLLDMYENEVVKFSASPNPVLQWTERGCRQVSHVFTNFGK
GIRYVSFEQYGRDTRSWVGHYGALVTHSSVRVRIRLS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgggagcccggccctctcggcgacggctgcccgcggacccgcccctagccttggacgcg
ctgcccccggagctgctggtgcaggtgttgagccacgtgcccccgcgcgcgctggtgacg
cgctgtcgcgcagtgtgccgcgcctggcgcgacgtggtggacgggcccaccgtgtggctg
ctgcagctggcccgcgaccgcagcgccgagggccgcgcactctacgcggtggcccagcgc
tgcccgcccaacagcgaggacgaggagttcccgctctgcgccctggcgcgctactgcctg
cgcgcgcccctcggccgaaacctcatcttcaactcctgcggagagcagggcttcagaggc
tgggaggtggagcatggcgggaatggctgggccgtggaaaagaacctaacactggtgccg
ggggctccttcccagacctgcttcgtgacttctttccaatggtgcttcaagaggcagctt
gtagacttggtgatggagggggtgtggcaggagctgctggacagcgcccagatcgagatc
tgtgtggccgattggtggggtgcccgagagaactgtggctgcatctaccggctccgggtc
cgcctcctggacatgtacgaaaacgaagtggtcaagttctcggcctcacccaacccggtc
cttcagtggacggagagaggctgccgacaggtgtctcatgtcttcaccaactttggcaag
ggcatccgctacgtgtcttttgagcagtatgggagggacacgcgttcctgggtggggcac
tatggcgccctggtgacccactccagtgtgagggtcaggatccgcctgtcctag

DBGET integrated database retrieval system