KEGG   Ailuropoda melanoleuca (giant panda): 100466346Help
Entry
100466346         CDS       T01329                                 

Gene name
ENPP1
Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase 1
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00230  Purine metabolism
aml00240  Pyrimidine metabolism
aml00500  Starch and sucrose metabolism
aml00740  Riboflavin metabolism
aml00760  Nicotinate and nicotinamide metabolism
aml00770  Pantothenate and CoA biosynthesis
aml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100466346 (ENPP1)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100466346 (ENPP1)
   00240 Pyrimidine metabolism
    100466346 (ENPP1)
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100466346 (ENPP1)
   00760 Nicotinate and nicotinamide metabolism
    100466346 (ENPP1)
   00770 Pantothenate and CoA biosynthesis
    100466346 (ENPP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:aml04090]
    100466346 (ENPP1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
    100466346 (ENPP1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     100466346 (ENPP1)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     100466346 (ENPP1)
CD molecules [BR:aml04090]
 Proteins
  100466346 (ENPP1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]
 Enzymes
  100466346 (ENPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Somatomedin_B Endonuclease_NS Sulfatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 100466346
NCBI-ProteinID: XP_011227954
Ensembl: ENSAMEG00000010477
Position
Un
AA seq 1000 aa AA seqDB search
MKARSARKPQKPHKTGKNDVSLIDECFGYIRYSEGCLFLSQGRAVVGSRALRELSLAPTQ
EKKKVTLSHPRPLQPIHPTHWKHRSVWPPLSRCRKASRASAASFSSSSRSILGPHDLMPS
ADHTLQFQSSPRREATQGDSCKCSEDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEV
KSCKGRCFERTFGNCRCDVACVDLGNCCLDYQETCIEPERIWTCSKFRCGEKRLSRSLCS
CSDDCRDKGDCCVNYGAVCRGEKSWVEETCESINEPQCPAGFETPPTLLFSLDGFRAEYL
HTWGGLLPVISKLKNCGTYTKNMRPAYPTKTFPNHYSIVTGLYPESHGIIDNKIYDPKMN
AFFALKSKEKFNPEWYKGEPIWHTAKYQGLKSGTFFWPGSDVEINGIFPDIYKIYNGSIP
FEERILAILKWLQLPKDERPHFYTLYLEEPDSSGHSYGPVSSEVIRALQRVDNMVGMLMD
GLQELNLHRCLNLILISDHGMEQGNCKKYVYLNKYLGDVKDIRIVYGPAARLRPSDVPDK
YFSFDYEDLARNLSCREPNQHFKPYLKHFLPKRLHFAKNDRIEPLTFYLDPQWQLALTPS
ERKDCGIGFHGSDNLLSNMQALFIGYGPGFKHNTEVDAFENIEVYNLMCDLLNLTPAPNN
GTHGSLNHLLKNPVYTPKNPKEVHPVVQCPSTRSPRRNLDCSCHPSVLPVVDFEIQLNLT
VAEEKVIKRSTLPYGRPRVLQRNTSACLLYQHQFVSGYSHDFLMPLWTSYTVDRNDSFSA
ENFSNCLYQDLRISLSPVHKCSFYKNNAELSYGFLYPPQLNKGSNQLYSEALLNTNIVPM
YQSFQVIWRYFHGTLLPRYAEERNGVNVVSGPVFDSDYDGCYDSSETLKQNSRLIRNQEI
LIPTHFFIVLTSCKNTFQTPSQCDDLDSLAFILPHRTDNSESCANGKHESSWVEELLRLH
RARIMDVEHITGLSFYQERKEPVSDILKLKTHLPTFNQED
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcacgatcagcgagaaaaccccagaaaccacataaaaccgggaaaaacgatgta
tccctcatagatgagtgctttggttacatcaggtattctgaagggtgcttattcctttct
caaggtagagcagtagtgggtagcagggccctgagggaactctcgcttgctcctacgcag
gagaaaaagaaggtcactttgtcccaccctcgacccctgcagcctattcacccgacccac
tggaaacacaggtcggtctggcctccactctcccgctgtagaaaagcttcccgggcctcg
gctgcatccttctcctcctcctcccgctctattttggggccccatgatctcatgccctct
gcagaccacactctgcaattccagtccagcccgcgccgcgaggccacgcagggcgattcc
tgcaagtgttccgaagaccccaacacctacaaggtgctctcgctggtattgtcggtctgt
gtgttaacaacaatccttggttgtatatttgggttgaaaccaagctgtgccaaagaagtt
aaaagttgcaaaggtcggtgttttgagagaacgtttggcaactgccgctgtgatgttgct
tgcgttgaccttggaaactgctgtctggattaccaggagacatgtatagaaccagaacgt
atatggacttgcagcaaattcaggtgtggtgagaaaaggttgtcccgaagcctttgctcc
tgttcagatgactgcagggacaagggcgactgctgtgtcaactacggcgccgtgtgccga
ggagagaaaagttgggtagaagaaacatgtgagagcattaatgagccacagtgtccagca
gggtttgaaacacctcctaccctcttattttccttggatggtttcagggcagaatattta
cacacctggggtggccttcttcctgttattagcaaactaaaaaactgtggaacatatacc
aaaaacatgagaccagcatatccaacaaaaacttttcccaatcactacagcattgtcact
ggactttatccagaatcccatggcataattgacaataaaatatatgatcccaaaatgaat
gctttctttgcacttaaaagtaaggagaaatttaatcctgagtggtacaaaggagaacca
atttggcacactgctaaatatcaaggcctgaaaagtggcacatttttttggccaggatca
gatgtggaaattaatggaattttcccagacatctataaaatatataatggttccataccg
tttgaagaaaggattttagctattcttaagtggttgcagcttcctaaagatgaaagacca
cacttttacactctgtatttagaagaaccagattcttcaggtcattcatatggaccagtc
agcagtgaagtcattagagcattgcagagggttgacaacatggttggcatgctgatggat
ggtctacaagagctgaacttgcatcgatgcctgaacctcatccttatttcagatcatggc
atggaacaaggcaattgcaagaaatatgtatatctgaataaatatttgggagatgttaaa
gatattagaattgtgtatggacctgcagctcggttgagaccctctgatgtcccagataag
tacttttcatttgattatgaagaccttgccagaaatctttcttgccgggaaccaaaccag
cacttcaaaccttacctgaaacatttcttaccaaagcgtttgcactttgccaaaaatgac
aggattgagcccttgacgttctatttggaccctcagtggcagcttgcattgactccttca
gaaaggaaagattgtgggattggattccatggttctgacaatttgctttcaaatatgcaa
gccctctttattggctatggacctggattcaagcacaacactgaagtggacgcctttgaa
aatatcgaagtctataacttaatgtgtgatttactgaatttgactcctgctcctaataat
ggaactcatggaagtcttaaccaccttctaaagaatcctgtttatacccccaagaatccc
aaggaagtccaccccgtggtacagtgcccttccacaagatcccccagacgtaaccttgac
tgctcgtgccatccttcggtcttgccagttgtggattttgagatacagttgaatttgact
gtggcagaagagaaggttattaagcgcagcactttaccttatggaagacccagagttctc
cagaggaacacctcggcctgtcttctctaccagcaccagttcgtgagtggttacagccac
gacttcctgatgcccctttggacctcttacaccgtcgacagaaatgacagtttctctgca
gaaaatttttccaactgtctttaccaggatcttcgaatttctcttagtcctgtccataag
tgttccttttataaaaataacgctgaactgagttacgggttcctctacccaccacaacta
aataaaggttcaaatcaactatattctgaagcattgcttaatactaatatagtgcccatg
taccagagttttcaagttatatggcgctactttcatggcacccttctgccaaggtatgca
gaagaaagaaatggcgtcaatgttgtcagtggtcctgtgtttgactctgattacgatgga
tgttatgattcctcagagaccctaaagcagaacagcagactcatccgtaatcaagaaatt
ctgatcccaactcacttcttcatcgtgctgacaagttgtaaaaacacattccagactccc
tcccagtgtgatgatttagacagcttagctttcattttgcctcacaggactgacaacagt
gagagctgtgcgaatgggaagcatgagtcttcatgggttgaagagttattgaggttacac
agagctcggatcatggatgttgaacacatcactggactcagcttctatcaagaaaggaaa
gagccagtttcagacattctaaagctgaaaacacatttgccaacctttaaccaagaagac
tga

DBGET integrated database retrieval system