KEGG   Ailuropoda melanoleuca (giant panda): 100466624Help
Entry
100466624         CDS       T01329                                 

Definition
(RefSeq) histone H2B type 2-E
  KO
K11252  histone H2B
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05034  Alcoholism
aml05203  Viral carcinogenesis
aml05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100466624
  Immune diseases
   05322 Systemic lupus erythematosus
    100466624
  Substance dependence
   05034 Alcoholism
    100466624
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100466624
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100466624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100466624
NCBI-ProteinID: XP_011215281
UniProt: D2I4V3
Position
Un
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccggcaaaatccgctcccgcgcccaagaagggctcgaaaaaggctgtcacc
aaagcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagttactccatc
tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system