KEGG   Ailuropoda melanoleuca (giant panda): 100466702Help
Entry
100466702         CDS       T01329                                 

Definition
(RefSeq) protein MRVI1
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100466702
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100466702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRVI1
Motif
Other DBs
NCBI-GeneID: 100466702
NCBI-ProteinID: XP_019648831
Ensembl: ENSAMEG00000001923
Position
Un
AA seq 771 aa AA seqDB search
MAPGNGTQPGSGMGVDLTCPFGVSSACGAQASWSIFGADTAEVPGTRGHSRQEAAMPHIP
EEEEPPGEPQAAQSPTGQGPHTAGISCSPPTIILTGDASSPEGETDKNLVNRAHSPHRRL
SHRHLKVSTASLTSVDPAGHVIDLVNDQLPDISISEEDKKKNLALLEEAKSVSERFLTRR
GRKSRNGPGDSPSAVSPNLSPGASPTSSQSNSLTVSTPPGLDACSGPQSPLPGAPPQQKG
DEAELSSPHLGEPNVSKGLADRKQNDQRKVSQGRLTPRSPTTEKSKETAIEQKENCAPLQ
CPEATPKGPASGVGSGGKMALNSPQPGPAENELGKALLKTAREGNPLPRGPAQGSGGVAP
LGPQGKGTAGEPTGSKFGSKAELRPPASRPPLQRGVSWDSGPEEPGPRLQKVLAKLPLAE
EEKRFSGKAGSKLAKAPGLKDFQIQVQPVRMQKLSKLREEHILIRNQNLVGLKLPELSEA
AEQEKGLPSELSSAIEEEEPKSGLDVMPNISDMLLRKLRVHRSLPGSAPPLTEKEVENVF
VQLSLAFRNDSYTLESRINQAERERNLTEENTEKELENFKASITSSASLWHHCEHRETYQ
KLLEDIAVLHRLAARLSSRAEMVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEF
KKLANQNSSRSCGPSEDGVPRTARSMSLTLGKNMPRRRVSVAVVPKFNALNMGGQTPSSS
PIPSLPALSESPNGKGNLPVTSALPALLEKAPFSILGLQNQSRKKIYVLGL
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggctcctggaaatggaacccagcctgggtcagggatgggagtggatttgacttgtcct
tttggcgtctcctcagcctgcggagcccaggcctcttggagcatctttggggctgacact
gcggaggttccgggcacacgtggccactcccgccaggaggctgccatgccccacattccc
gaggaggaggagccccctggagagccacaggcagcccagagtcccaccggccaaggccct
cacactgcaggaatatcctgcagtccacctaccatcatcttgactggggatgccagttca
ccggaaggagaaactgacaaaaacttggtcaacagagctcacagtccccacaggaggctt
tcccaccgacacttgaaggtttctactgcttcactgacttctgtggatcctgcagggcac
gttattgacctggtcaatgaccagctgccagacatcagcatctcagaagaggacaagaag
aaaaacctggcgctgcttgaagaagccaagtcggtgagtgaacgattcctgacccgccgt
gggaggaagtccaggaacggccccggagactccccgtcagctgtttccccgaacctcagc
cccggagcttctccgacatcctctcaaagcaactcacttactgtctccacgccacctggt
ttggatgcatgcagtggcccacagtcccctttgcctggagcaccaccgcagcagaagggg
gatgaggccgaactctcttcacctcatcttggcgagcctaatgtctccaaagggctagct
gaccggaagcagaatgaccagaggaaagtgtctcagggcaggctgactcctcgttctccc
acaactgagaagtccaaagagactgcaattgaacaaaaggaaaactgcgctcccctccag
tgccctgaggccacacccaaaggcccagcttctggcgtaggcagtggtgggaaaatggcc
ctgaatagccctcagcctggccctgctgaaaatgagctgggaaaggcacttctgaagaca
gctagggaaggcaaccctctgcccagaggtccagcccagggctctggaggggtggctccc
ctgggccctcagggaaaaggtacagctggagagccaacagggtcaaaatttggctccaaa
gctgagctgcggccccctgcttcccggccgcccctacagcggggagtctcctgggacagt
ggtcctgaagaacccggcccccggttgcagaaagtgcttgccaagctgcctctggcagag
gaagagaaacgtttttcgggcaaagctggcagcaagttggccaaggcacccggactcaaa
gactttcagatacaagtgcagccagtacggatgcaaaaactgtctaagctccgtgaggag
cacatcctgataagaaatcagaacttagtggggctcaagcttccagaacttagtgaagcg
gctgagcaggaaaaagggctcccttctgaactctcctcagctattgaggaagaagagcca
aagagtggcttggatgtcatgcccaatatttctgacatgctgctgcgcaaactgcgggtc
cacaggtctctccctggaagtgcccctccgctcactgaaaaggaagttgagaacgtgttt
gtacaactgtccttggcctttagaaatgacagctacactctggaatctagaattaaccag
gctgaaagggaacgcaacctaacagaggagaacacagagaaggaactggaaaacttcaaa
gcttctattacgtcctcagcttcactatggcaccactgtgagcaccgagagacctaccag
aagctgctggaggatatcgctgtcctgcaccgcttggctgcgcgcctctccagcagagct
gagatggtgggggccgtccgccaggaaaagcgcatgtcaaaggcaacagaagtaatgatg
cagtacgtggaaaatctgaagaggacgtatgagaaagaccatgcagagctcatggagttt
aaaaaacttgcaaatcagaattcaagccgcagctgtggcccctctgaagatggagtccct
cgaacagcgcggtccatgtccctcacactgggaaagaacatgccccgccggagggtcagc
gttgcagtggttcccaagtttaatgccctgaacatggggggtcaaactcccagctcatca
cccatcccctccttaccagccctgtcagaatcacccaacgggaaaggcaatctacctgtc
acctcagcactgcctgcacttttggaaaaggccccattctctattcttggcctacagaac
caatcaaggaaaaagatctatgtcctcggtctttga

DBGET integrated database retrieval system